© Rockefeller University Press, 0022-1007 $8.00
JEM, Volume 202, Number 10, 1423-1431
This Article
Abstract
PDF (Full Text)
Supplemental Material Index
Alert me when this article is cited
Citation Map
Services
Alert me to new content in the JEM
Download to citation manager
Google Scholar
Articles by Shinohara, H.
Articles by Kurosaki, T.
PubMed
PubMed Citation
Articles by Shinohara, H.
Articles by Kurosaki, T.

ARTICLE

PKCß regulates BCR-mediated IKK activation by facilitating the interaction between TAK1 and CARMA1

Hisaaki Shinohara1, Tomoharu Yasuda1, Yuichi Aiba1, Hideki Sanjo1, Megumi Hamadate1, Hiroshi Watarai2, Hiroaki Sakurai3, and Tomohiro Kurosaki1

1 Laboratory for Lymphocyte Differentiation, RIKEN Research Center for Allergy and Immunology, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan
2 Laboratory for Immune Regulation, RIKEN Research Center for Allergy and Immunology, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan
3 Division of Pathogenic Biochemistry, Institute of Natural Medicine, Toyama Medical and Pharmaceutical University, Toyama 930-0194, Japan

CORRESPONDENCE Tomohiro Kurosaki: kurosaki{at}rcai.riken.jp

 Top
 Abstract
 Results
 Discussion
 Materials and Methods
 References
 
The B cell antigen receptor (BCR)–mediated activation of I{kappa}B kinase (IKK) and nuclear factor–{kappa}B require protein kinase C (PKC)ß; however, the mechanism by which PKCß regulates IKK is unclear. Here, we demonstrate that another protein kinase, TGFß-activated kinase (TAK)1, is essential for IKK activation in response to BCR stimulation. TAK1 interacts with the phosphorylated CARMA1 (also known as caspase recruitment domain [CARD]11, Bimp3) and this interaction is mediated by PKCß. IKK is also recruited to the CARMA1–Bcl10–mucosal-associated lymphoid tissue 1 adaptor complex in a PKCß-dependent manner. Hence, our data suggest that phosphorylation of CARMA1, mediated by PKCß, brings two key protein kinases, TAK1 and IKK, into close proximity, thereby allowing TAK1 to phosphorylate IKK.


Abbreviations used: Ab, antibody; BCR, B cell antigen receptor; CARD, caspase recruitment domain; CARMA1, caspase recruitment domain [CARD]11, Bimp3; EMSA, electrophoretic mobility shift assay; ERK, extracellular signal–regulated kinase; GST, glutathione S-transferase; IKK, I{kappa}B kinase; JNK, c-Jun NH2-terminal kinase; MAGUK, membrane-associated guanylate kinase; MALT, mucosal- associated lymphoid tissue; MAP, mitogen-activated protein; PKC, protein kinase C; TAK, TGFß-activated kinase.

Triggering of the B cell antigen receptor (BCR) leads to the initiation of multiple signaling pathways that regulate cellular proliferation and survival of immature and naive B lymphocytes, and the effector functions of mature B cells (1). Among them, the signaling pathway that leads to the activation of transcription factors of NF-{kappa}B has a crucial role in these processes (24). NF-{kappa}B is also activated in response to variety of other stimuli such as CD40 or Toll-like receptors, therefore raising the possibility of the existence of signal-specific pathways for activation (5, 6). The common feature of signals that induce NF-{kappa}B is activation of an I{kappa}B kinase (IKK) complex consisting of two catalytic subunits, IKK{alpha} and IKKß, and an essential regulatory subunit NF-{kappa}B essential modulator (NEMO)/IKK{gamma}. In the canonical pathway, IKKß activation results in phosphorylation and subsequent degradation of I{kappa}Bs, thereby allowing NF-{kappa}B proteins to translocate to the nucleus (68). BCR signal largely utilizes this pathway to activate NF-{kappa}B.

Upon BCR-mediated signaling, protein kinase C (PKC)ß is activated, which in turn is important for IKK activation (911). By other stimuli including IL-1 and TNF-{alpha}, TGFß-activated kinase (TAK)1, another protein kinase and a member of the mitogen-activated protein (MAP) 3 kinase family, has been reported to participate in IKK activation (1219). In addition to PKCß, BCR stimulation requires adaptor molecules, CARMA1 (also known as caspase recruitment domain [CARD]11, Bimp3), Bcl10, and mucosal-associated lymphoid tissue (MALT)1, to activate NF-{kappa}B (3, 20). Indeed, B cells lacking any of these proteins are defective in IKK activation in response to BCR stimulation (2127). CARMA1 contains a set of motifs (PDZ, SH3, and GUK domains) that define the membrane-associated guanylate kinase (MAGUK) family, peripheral membrane proteins that serve as molecular scaffolds by clustering different signaling and structural proteins into membrane subdomains (28, 29). In overexpression studies, CARMA1 directly binds to Bcl10 through CARD–CARD interactions and Bcl10 interacts with MALT1 (28, 3032). Recently, MALT1 and Bcl10 have been shown to mediate IKK activation by facilitating the K63 polyubiquitination of the IKK{gamma} (3336), although it remains obscure whether this polyubiquitination event suffices for IKK activation in the context of antigen receptor signaling.

Although adaptor proteins that participate in BCR-mediated IKK activation have been intensively identified, it remains unclear whether the PKCß and CARMA1–Bcl10–MALT1 complex connect and how, if any, these connections lead to IKK activation. Here, we report that BCR-induced phosphorylation of CARMA1, mediated by PKCß, contributes to bringing two key protein kinases, TAK1 and IKK, into close proximity. As a result, TAK1 is able to function as an upstream kinase for IKK activation in BCR signaling context.


   Results
 Top
 Abstract
 Results
 Discussion
 Materials and Methods
 References
 
TAK1 is required for BCR-mediated IKK activation
Given the previous evidence that BCR-mediated IKK activation is impaired in protein kinase C (PKC)ß- or CARMA1-deficient primary B cells (10, 11, 2124), we examined whether requirement for these molecules is recapitulated in DT40 B cells. For this purpose, we established PKCß- or CARMA1-deficient cells. As shown in Fig. 1, both of these deficient DT40 cells failed to activate IKK and degrade I{kappa}B{alpha} upon BCR engagement. The defective NF-{kappa}B activation in PKCß- or CARMA1-deficient DT40 cells was not due to the decreased BCR expression (Fig. S1 B, available at http://www.jem.org/cgi/content/full/jem.20051591/DC1). These observations allowed us to choose the chicken DT40 B cell system for elucidating the molecular connections between PKCß and IKK in BCR signaling. Expression of BCR and signaling molecules in various mutant DT40 B cell lines used in this study are presented in Fig. S1.



View larger version (33K):
[in this window]
[in a new window]
 
Figure 1. PKCß and CARMA1 are essential for IKK activation in DT40 cells. BCR-mediated IKK activation in DT40 wild-type (wt), PKCß- (PKCß–/–), and CARMA1-deficient (CARMA1–/–) DT40 B cells. For IKK activation, 107 cells/lane were subjected to IKK kinase assay. IKK kinsae activity was measured by phosphorylation of GST-I{kappa}B{alpha} as a substrate and detected by anti–phospho-I{kappa}B{alpha} mAb (top). I{kappa}B{alpha} degradation was analyzed by Western blotting with anti-I{kappa}B{alpha} Ab (middle). NF-{kappa}B activity was examined by EMSA (bottom). Position of the NF-{kappa}B complex is indicated by arrow.

 
Activation of IKK by all proinflammatory and innate immune stimuli depends on phosphorylation of either IKK{alpha} or IKKß catalytic subunits at two conserved serines located within their activation loops (37). Such phosphorylation could be achieved through the action of an upstream kinase. If this is the case in BCR signaling, the aforementioned data suggest that PKCß or another kinase functions as the upstream kinase in IKK activation. In this regard, recent reports have implicated MAP3 kinases, including TAK1, as a candidate kinase (1416, 34). To address the role played by TAK1 in BCR-mediated IKK activation, we first examined whether TAK1 is indeed activated by BCR ligation. TAK1 was reported to be activated via autophosphorylation after exposure of cells to IL-1 (38, 39). Therefore, TAK1 was immunoprecipitated from resting and activated primary murine B cells and we measured its in vitro autophosphorylation activity. TAK1 was activated at least 3 min after BCR cross-linking (Fig. 2 A). Although we used this assay for DT40 B cells, enhancement of its in vitro kinase activity could not be reproducibly observed. To circumvent this potential difficulty in DT40 B cells, we took another approach. The status of serine/threonine phosphorylation of Flag-tagged TAK1 was monitored in DT40 B cells after BCR cross-linking. This tagged TAK1 underwent phosphorylation 3 min after BCR cross-linking, whereas its kinase-deficient mutant barely did (Fig. 2 D, top). Together, we conclude that TAK1 is activated by BCR ligation in primary B cells and probably in DT40 B cells.



View larger version (38K):
[in this window]
[in a new window]
 
Figure 2. TAK1 is required for BCR-mediated IKK activation. (A) For TAK1 activation, primary B cells from spleens of C57BL/6J mice were purified and stimulated by anti–mouse IgM F(ab)2 (anti-µ). Cytosolic extracts from 4 x 107 cells per sample were immunoprecipitated with anti-TAK1 Ab, and the resulting immunocomplexes were subjected to in vitro kinase assay. To measure the activity of TAK1, autophosphorylation of TAK1 was detected by anti–phospho-serine/threonine (P-ST) Abs. (B) IKK activity, degradation of I{kappa}B{alpha}, and NF-{kappa}B activation in TAK1-deficient DT40 cells (TAK–/–) or DT40 wild-type cells (wt) were determined with the same procedures as in Fig. 1. (C) For ERK activation, whole cell lysates (106 cells/ lane) were analyzed by Western blotting with anti–phospho-p44/p42 MAP kinase polyclonal Ab. For JNK activation, 2 x 107 cells were used for in vitro kinase assay as described in Materials and methods. (D) For TAK1 activity in DT40 cells, Flag-tagged wild type TAK1 (TAK1 wt) or kinase-dead TAK1 (TAK1 K63W) was transfected into TAK1-deficient DT40 cells. Cell lysates (2 x 107 cells/ lane) were immunoprecipitated with anti-Flag mAb and analyzed by Western blotting using anti–phospho-serine/threonine Abs. IKK kinase assay and detection of I{kappa}B{alpha} degradation were performed as in Fig. 1.

 
Next, to directly examine the functional role of TAK1, we established a DT40 cell line deficient in this molecule (Fig. S1 A). As shown in Fig. 2 B, BCR-mediated NF-{kappa}B activation was abolished in TAK1-deficient DT40 B cells. Effects of TAK1 on key MAP kinases, extracellular signal–regulated kinase (ERK) and c-Jun NH2-terminal kinase (JNK), were also analyzed by Western blotting with antibodies (Abs) specific for their phosphorylated forms. ERK kinase in TAK1-deficient cells was activated normally by BCR cross-linking, but JNK phosphorylation was completely abolished (Fig. 2 C). Activation of IKK and JNK by BCR ligation was restored by introduction of wild-type TAK1 into TAK1-deficient cells, but not by its kinase mutant (Fig. 2 D). Thus, we conclude that TAK1 kinase activity is required for BCR-mediated IKK and JNK activation in DT40 B cells.

Normal PKCß activation in the absence of TAK1
As demonstrated before, TAK1-deficient DT40 B cells manifested the similar defect in BCR-mediated IKK activation to that in PKCß- and CARM1-deficient B cells, suggesting the functional interaction between TAK1 and PKCß/CARMA1. Thus, to elucidate the mechanism by which TAK1 participates in BCR-mediated IKK activation, we first examined the effects of deletion of TAK1 on PKCß and CARMA1. As for its effect on PKCß, the activation status of PKCß was, as judged by using anti–phospho-PKCß Ab, not affected in TAK1-deficient DT40 B cell (Fig. 3 A). Thus, PKCß likely lies upstream of TAK1, thereby contributing to BCR-mediated IKK activation. As a readout of CARMA1 action, we considered the possibility that CARMA1 might undergo serine/threonine phosphorylation upon BCR engagement because a physical interaction between CARMA1 with PKC{theta} was reported in nonlymphoid cells (40). Indeed, CARMA1 underwent phosphorylation, as determined by anti–phospho-serine/threonine Ab by BCR cross-linking in DT40 B cells. This CARMA1 phosphorylation occurred even in TAK1-deficient cells, but the extent was decreased by ~20% at 3 min after stimulation when compared with wild-type cells (Fig. 3 B).



View larger version (29K):
[in this window]
[in a new window]
 
Figure 3. Normal PKCß activation in the absence of TAK1. (A) PKCß activity was determined by phosphorylation status using anti–phospho-PKCß Ab (T500; corresponding to human PKCß threonine 500) in wild-type (wt) or TAK–/– DT40 cells. (B) For phosphorylation of CARMA1 in wild-type or TAK–/– DT40 cells, cytosolic extracts from 4 x 107 cells per sample were immunoprecipitated with anti-CARMA1 Ab and analyzed by Western blotting using anti–phospho-serine/ threonine Abs (P-ST). (C) For TAK1 activity in various mutant DT40 cells, Flag-tagged wild-type TAK1 (TAK1 wt) was transfected into TAK–/–, PKCß–/–, or CARMA1–/– DT40 cells. Activation status of TAK1 was determined as in Fig. 2 D.

 
In the absence of PKCß or CARMA1, TAK1 activation, judged by anti–phospho-serine/threonine blotting, was greatly decreased, compared with wild-type DT40 B cells (Fig. 3 C). These observations suggest that PKCß- and CARMA1-mediated events augment TAK1 activity during BCR signaling.

Interaction of TAK1 with CARMA1
To further address the mechanism by which TAK1 leads to the activation of IKK, we analyzed whether TAK1 interacts with PKCß and/or CARMA1 in DT40 B cells that are unstimulated or stimulated. Efficient interaction between TAK1 and CARMA1 was observed in stimulated B cells (Fig. 4 A). This inducible association was also observed in primary B cells after BCR stimulation (Fig. 4 B). Although fivefold higher amount of TAK1 was immunoprecipitated, we could not detect reproducible association of TAK1 with PKCß (unpublished data). To assess the functional importance of this association, we made TAK1 mutants and examined their functions. The COOH-terminal region of TAK1 (402–579 amino acids) is thought to bind to a TAK1-binding protein, TAB2, in the IL-1 signaling pathway (41). In contrast with the dB mutant, the dA mutant failed to associate with CARMA1 upon BCR engagement and to activate IKK (Fig. 5, A–C). This failure was not due to its defective kinase activity because the immunoprecipitated dA TAK1 mutant, once overexpressed in 293T cells, exhibited the similar kinase activity to that of wild-type (Fig. 5 D). Therefore, we conclude that after BCR stimulation, TAK1 is recruited to CARMA1 directly or indirectly, which in turn contributes to subsequent IKK activation.



View larger version (27K):
[in this window]
[in a new window]
 
Figure 4. TAK1 associates with CARMA1. (A) For detection of molecular interaction, cell lysates from TAK1-deficient DT40 cells expressing Flag-tagged wild-type TAK1 were immunoprecipitated with anti-Flag mAb and analyzed by Western blotting using anti-CARMA1 Ab. (B) The primary B cells from spleens of C57BL/6J mice were purified and stimulated by anti–mouse IgM F(ab)2 (anti-µ). Cytosolic extracts from 4 x 107 cells per sample were immunoprecipitated with anti-CARMA1 Ab, and the immunocomplexes were subjected to Western blotting using anti-TAK1 Ab.

 


View larger version (25K):
[in this window]
[in a new window]
 
Figure 5. Requirement for interaction between TAK1 and CARMA1 in NF-{kappa}B activation. (A) Schematic diagram of various TAK1 mutant constructs. (B) Interaction of various mutant TAK1 with CARMA1. TAK1 mutants were transfected into TAK1-deficient DT40 cells. Cell lysates (2 x 107 cells/ sample) were immunoprecipitated by anti-Flag mAb, followed by Western blotting using anti-CARMA1 Ab. (C) Detection of I{kappa}B{alpha} degradation was performed as in Fig. 1. (D) For detection of potentiality of these mutant TAK1 kinase activity, each construct shown in A was transiently transfected with TAB1 into 293T cells. Cells were lysed and immunoprecipitated by anti-Flag mAb. The immunocomplexes were subjected to kinase assay using GST-IKKß as a substrate. In lane 1 (asterisk), GST-IKKß in which S177 and S181 were mutated to A177 and A181 was used as a negative control substrate.

 
Interaction of TAK1 with CARMA1 is dependent on PKCß
Having demonstrated the necessity of interaction between TAK1 and CARMA1 in BCR-mediated IKK activation, next we determined how this association is formed. As CARMA1 was phosphorylated by BCR stimulation, we reasoned that BCR-induced interaction between TAK1 and CARMA1 might be associated with CARMA1 phosphorylation status. As shown before, phosphorylation of CARMA1 at 3 min after BCR stimulation occurred in TAK-deficient DT40 B cells. Thus, we considered PKCß as a key kinase for initiating phosphorylation of CARMA1 after BCR stimulation. In the absence of PKCß, the phosphorylation of CARMA1 was not induced by BCR ligation (Fig. 6 A). Importantly, BCR-mediated interaction between TAK1 and CARMA1 was also greatly reduced in PKCß-deficient DT40 B cells. Thus, at 3 min after BCR stimulation, the CARMA1 phosphorylation status appeared to be well correlated with the interaction status between TAK1 with CARMA1 (Fig. 6, A and B). Moreover, comparison of wild-type and PKCß-deficient DT40 B cells indicated that inducible association of CARMA1 with Bcl10 and MALT1 was also well correlated with the phosphorylation status of CARMA1 at 3 min after receptor ligation (Fig. 6 C). Together, these observations suggest that the initial phase of CARMA1 phosphorylation could contribute to its inducible association with TAK1 and Bcl10.



View larger version (29K):
[in this window]
[in a new window]
 
Figure 6. Interaction of TAK1 with CARMA1 is dependent on PKCß. (A) For phosphorylation of CARMA1 in wild-type or PKCß–/– DT40 cells, immunoprecipitation and Western blotting were performed as Fig. 3 B. (B) For association of TAK1 and CARMA1, cell lysates from TAK1- or PKCß-deficient DT40 cells, both of which expressed Flag-tagged wild-type TAK1, were immunoprecipitated with anti-Flag mAb and analyzed by Western blotting using anti-CARMA1 Ab. (C) For interaction of CARMA1 with Bcl10 or MALT1 in PKCß–/– cells, cytosolic extracts from 4 x 107 cells per sample were immunoprecipitated with anti-CARMA1 Ab and analyzed by Western blotting using anti-Bcl10 or -MALT1 Abs.

 
Although CARMA1 phosphorylation, judged by anti–phospho-serine/threonine Ab, continued 10 min after BCR ligation, its association with TAK1 and Bcl10 was decreased to an almost resting level (Fig. 6, A–C). Assuming that CARMA1 undergoes phosphorylation on multiple serine and threonine residues upon BCR stimulation, one of the straightforward explanations for these observations is that the initial phosphorylation sites could contribute to association of CARMA1 with TAK1 and Bcl10, whereas the sites, being phosphorylated in the later phase (10 min after stimulation), could play a negative role in its association.

TAK1 is able to phosphorylate IKK
Given the importance of the CARMA1–Bcl10–MALT1 complex in IKK activation, the aforementioned data suggest that TAK1, when interacted with the phosphorylated CARMA1, gains access to its substrate IKK, which in turn transphosphorylates conserved serines located within the activation loop of IKKß/IKK{alpha}. Hence, to test this hypothesis, we examined whether IKK is associated with CARMA1 after BCR cross-linking and, if so, whether this association is dependent on PKCß. As demonstrated in Fig. 7 A, this inducible association was detected and dependent on PKCß.



View larger version (33K):
[in this window]
[in a new window]
 
Figure 7. TAK1 is able to phosphorylate IKK. (A) For IKK recruitment to CARMA1, 2 x 107 cell lysates were immunoprecipitated by anti-IKK{gamma} mAb and analyzed by Western blotting using anti-CARMA1 Ab. (B) Cell lysates from the transfectants, as seen in Fig. 2 D, were immunoprecipitated by anti-Flag mAb and performed in vitro kinase assay using GST-IKKß as a substrate. In the lane 4 (asterisk), GST-IKKß in which S177 and S181 were mutated to A177 and A181 was used as a negative control substrate.

 
We also tested whether TAK1 is able to phosphorylate IKKß. For this purpose, transfected Flag-tagged TAK1 and its kinase-defective mutant were immunoprecipitated from stimulated DT40 B cells, and incubated with recombinant glutathione S-transferase (GST)-IKKß as a substrate. As demonstrated in Fig. 7 B, only wild-type TAK1 led to strong phosphorylation of recombinant GST-IKKß after stimulation. As a further negative control, we also used a recombinant GST-IKKß mutant in which two conserved serine residues (S177 and S181) in the activation loop of IKKß were changed to alanine residues (Fig. 7 B, lane 4), demonstrating that these sites are indeed phosphorylated by immunoprecipitated TAK1. The aforementioned data raised the possibility that either TAK1, or a kinase that may associate with the TAK1 immunocomplex, is one of the IKK kinases.


   Discussion
 Top
 Abstract
 Results
 Discussion
 Materials and Methods
 References
 
Despite the importance of PKCß in BCR-induced IKK activation, the underlying mechanism has remained unclear. In this study, we provide several lines of evidence in support of the critical role of PKCß-mediated phosphorylation of CARMA1 in bringing two key enzymes TAK1 and IKK into close proximity with each other, thereby activating IKK by BCR stimulation. A model for the mechanism of PKCß-mediated activation of IKK during BCR signaling, based on the data presented here, is shown in Fig. 8. Involvement of PKCß in BCR-mediated CARMA1 phosphorylation is clear; however, our data has not addressed the issue of whether PKCß phosphorylates CARMA1 after BCR stimulation, directly or indirectly. In this regard, as in T cells, PDK1 might facilitate the functional interaction between PKCß and CARMA1 in B cells (42).



View larger version (28K):
[in this window]
[in a new window]
 
Figure 8. A model for BCR-mediated NF-{kappa}B activation. Stimulation of BCR leads to activation of proximal protein tyrosine kinases including Syk and Btk. Btk phosphorylates several tyrosine residues on phospholipase C-{gamma}2 (PLC-{gamma}2), and subsequent activation of protein kinase Cß (PKCß). Activated PKCß phosphorylates CARMA1 (1), directly or indirectly, which is able to recruit TAK1 to the phosphorylated CARMA1 (2). Meanwhile, the IKK complex probably through the Bcl10/ MALT1 complex is recruited to the phosphorylated CARMA1 (3 and 4). These interactions (CARMA1-IKK and CARMA1-TAK1) contribute to access of two key protein kinases, TAK1 and IKK, leading to activation of the IKK complex (5).

 
The initial phosphorylation of CARMA1 (3 min after stimulation) mediated by PKCß is most likely to cause its association with TAK1 and Bcl10/MALT1 complex, which is supported by two lines of our observations. First, the comparison between wild-type and PKCß-deficient DT40 cells clearly showed the well correlation between the inducible phosphorylation status of CARMA1 and its association with TAK1, Bcl10, and MALT1 at 3 min after BCR stimulation (Fig. 6). Second, BCR-mediated phosphorylation of CARMA1 still occurred in TAK1-deficient DT40 cells (Fig. 3 B), implying that the initial CARMA1 phosphorylation precedes its association with TAK1 during BCR signaling.

Next, the question of how CARMA1 phosphorylation contributes to its association with Bcl10 and TAK1 arises. CARMA1 contains a set of motifs (PDZ, SH3, and GUK domains) that define MAGUK family proteins (29, 43). The best characterized member of this family, PSD-95, forms relatively stable, detergent-resistant, and microfilament-independent multiprotein aggregations at postsynaptic membrane densities in neurons (44, 45). Furthermore, it has been proposed that the intramolecular interactions of PSD-95, such as between the SH3 and GUK domains, keep it in a closed, inactive conformation, whereas binding to a regulatory ligand could induce an opening of the conformation that would allow for subsequent intermolecular SH3–GUK interactions and dimerization or multimerization. In addition to MAGUK-typical features, CARMA1 contains two additional protein–protein interaction domains; a CARD domain and a coiled-coil domain. The CARD domain of CARMA1 is shown to mediate binding to Bcl10, whereas its coiled-coil domain is thought to mediate homo- and/or hetero-multimerization (23, 28, 32). Thus, it is reasonable to anticipate that the initial phosphorylation of CARMA1 (3 min after stimulation), like the regulatory ligand, could induce the opening state from its closed conformation, thereby allowing CARMA1 to form homo-oligomerization and hetero-oligomerization with signaling molecules, including Bcl10 and TAK1. However, disparity between phosphorylation status of CARMA1 and its association with Bcl10 and TAK1 (10 min after stimulation) was also observed. These data suggest that CARMA1 might undergo phosphorylation on several serine/threonine residues with distinct time kinetics during BCR signaling and that the sites being phosphorylated with later time kinetics could contribute to terminating these associations.

Although endogenous Bcl10 and MALT1 can be coimmunoprecipitated from lysates of nonstimulated B and T cells, the physical association of Bcl10 and MALT1 is not clear (31). In the case of DT40 B cells, we observed that this association was inducible (unpublished data). Given that Bcl10 undergoes phosphorylation in antigen receptor signaling (46, 47), this phosphorylation might contribute to further association of Bcl10 and MALT1, thereby making a stable CARMA1–Bcl10–MALT1 complex upon BCR engagement. IKK{gamma} was recruited to CARMA1 after receptor ligation (Fig. 7 A). Thus, the IKK complex including IKK{gamma} might be directly associated with CARMA1–Bcl10–MALT. It is also possible that TRAF6 and/or ECSIT (evolutionarily conserved signaling intermediate in toll pathways) might function as a connecting molecule between CARMA1–Bcl10–MALT1 and the IKK complex (33, 34, 48).

Importance of phosphorylation of the activation loop serine residues of IKK{alpha} and IKKß has been demonstrated in vivo as well as in vitro experiments (37, 49, 50). As these serine residues are not part of a PKC consensus phosphorylation site, two mechanistic ideas have been proposed. First, other serine/threonine residues of IKK{alpha} and IKKß may serve as direct substrates of PKCß, thereby contributing to IKK activation. Alternatively, PKCß may regulate IKK indirectly through an intermediate kinase that would be directly or indirectly controlled by PKCß. Although the first possibility cannot be completely excluded, our data highly suggest that the second mechanism mainly operates in the BCR signaling context and that TAK1 corresponds to this intermediate kinase. First, consistent with a previous report using Jurkat T cells (34), TAK1 was demonstrated to play a critical role in BCR-mediated IKK activation in DT40 B cells. Second, because PKCß activation occurred normally in the absence of TAK1, TAK1 is likely activated downstream of PKCß. Third, immunoprecipitated TAK1, but not its kinase mutant, was able to phosphorylate activation loop serine residues of IKKß in in vitro conditions.

In contrast with wild-type DT40 cells, TAK1 activation status, as judged by antiphosho-serine/threonine Ab, was greatly decreased in both PKCß- and CARMA1-deficient cells, suggesting involvement of PKCß-mediated CARMA1 phosphorylation and probably subsequent association of CARMA1 and TAK1 in its activation. In this regard, the dA TAK1 mutant is thought to be devoid of a binding site to TAB2, an adaptor molecule linking TRAF6 and TAK1 in IL-1 receptor signaling (41). Thus, TAB2 could be one of the candidates that contribute to association of CARMA1 with TAK1. In addition to TAK1 activation, substrate accessibility is important. Association of both TAK1 and IKK complex with CARMA1 and dependency of these associations on PKCß were clearly demonstrated by this study. Hence, these associations likely allow the activated TAK1 to phosphorylate IKKß in in vivo contexts. Furthermore, because MALT1 is reported to activate IKK by promoting the ubiquitination of the IKK{gamma} directly, or indirectly through TRAF6 (3335), this IKK{gamma} ubiquitination may contribute to bringing IKKß into a state that is more susceptible to being phosphorylated by TAK1.

TAK1 was reported as a kinase coupling innate receptors, Toll-like receptors/IL-1 receptors, to IKK activation (1217). Therefore, involvement of this kinase also in antigen receptor–mediated IKK activation is somewhat surprising. Here, the relative lack of redundancy in BCR-mediated IKK activation in DT40 cells has enabled us to provide an insight into how TAK1 participates in adaptive immune receptor signaling such as through BCR. Phosphorylation of a specific scaffold molecule, CARMA1, recruits actions of two common NF-{kappa}B players, TAK1 and IKK, into the adaptive immune receptor signaling. Thus, the adaptive immune system in vertebrates may have evolved from the more primitive innate immune system through usurping the common key signaling components of the NF-{kappa}B pathway, including TAK1 and IKK, by using CRAMA1–Bcl10–MALT1.


   Materials and Methods
 Top
 Abstract
 Results
 Discussion
 Materials and Methods
 References
 
Cells, mice, Abs, and reagents
Wild-type and various mutant DT40 cells were cultured in RPMI 1640 (GIBCO BRL and Invitrogen) supplemented with 10% FCS, 1% chicken serum, 50 µM 2-ME (Sigma-Aldrich), 4 mM L-glutamine, and antibiotics. Wild-type C57BL/6J mice were purchased from Clea Japan. Anti-CARMA1 Ab and anti-I{kappa}B{alpha} Ab were obtained by immunizing rabbits with synthetic peptide (CLQFVSRSENKYKRMNSNERVRI) and with bacterially expressed GST fusion proteins containing amino acid sequences coding chicken I{kappa}B{alpha} (amino acids 1–103), respectively. Anti–chicken IgM mAb, M4 (51), was used for stimulation of BCR and FACS analysis. Anti-ERK Ab, anti-JNK Ab, anti-TAK1 mAb (C9), anti-Bcl10 mAb (331.3), and anti-MALT1 Ab were purchased from Santa Cruz Biotechnology, Inc. Anti–phospho-PKCß (T 500) Ab, anti-PKCßII Ab, anti-CARMA1 Ab, and anti-TAK1 Ab were obtained from Abcam. Anti-IKK{gamma} mAb was obtained from BD Biosciences. Anti–phospho-ERK Ab, anti–phospho-I{kappa}B{alpha} mAb (5A5), anti–phospho-IKK{alpha}/ß (S177 /S181), and anti–phospho-threonine Ab were purchased from Cell Signaling Technology Inc. Anti–phospho-serine Ab was obtained from Zymed Laboratories. The mixture of anti–phospho-serine and -threonine Ab were used as anti–phospho-serine/threonine Ab. Anti-FLAG mAb (M2) was obtained from Sigma-Aldrich.

Expression constructs and transfection
Flag-tagged mouse wild-type TAK1 and its mutant cDNAs were generated by PCR. Each cDNA was cloned into the pApuro with IRES-GFP expression vector (52). Kinase-dead TAK1, dA TAK1, and dB TAK1 harboured K63W point mutation, internal deletion (amino acids 401–530), and COOH-terminal deletion (amino acids 531–579), respectively. These constructs were transfected into each mutant DT40 cells by electroporation as described elsewhere (51).

Generation of various deficient DT40 cells
Based on published sequence of murine PKCßII, CARMA1, and TAK1, we searched each chicken homologue using the expressed sequence tag database and obtained each chicken cDNA by RT-PCR with RNA from DT40 B cells. Genomic clones of PKCßII, CARMA1, and TAK1 were obtained by PCR using oligonucleotides (designed from each cDNA sequence) and genomic DNA as a template. The targeting vector, pPKCßII-neo or pPKCßII-hisD, was constructed by replacing the genomic fragment containing exons that correspond to murine PKCßII ATP-binding domain with neo or hisD cassette. The targeting constructs for CARMA1 were designed for neo and hisD cassettes to replace the genomic fragment of chicken CARMA1 exons 2–7. The targeting constructs for TAK1 were designed for neo and hisD cassettes to replace the genomic fragment corresponding to murine TAK1 ATP-binding domain. These targeting vectors were sequentially transfected into DT40 cells, resulting in generation of PKCßII-, CARMA1-, or TAK1-deficient DT40 cells, as described previously (51).

Immunoprecipitation and Western blot analysis.
For immunoprecipitation, cells were solubilized in NP-40 lysis buffer supplemented with protease and phosphatase inhibitors as described previously (51) and precleared lysates were incubated with proper Abs and protein G–sepharose (GE Healthcare). For Western blot analysis, immunoprecipitates or cleared-cell lysates were resolved on SDS-PAGE, transferred to polyvinyldifluoride (PVDF) membrane (Bio-Rad Laboratories), and incubation with secondary horseradish peroxidase–labeled (GE Healthcare) or alkaline phosphatase–labeled (Santa Cruz Biotechnology, Inc.) Abs. The blots were washed and visualized with the SuperSignal West Dura Extended Duration Substrate (Pierce Chemical Co.) or BCIP/NBT Color Development system (Promega).

Electrophoretic mobility shift assay (EMSA)
DNA-binding activity of NF-{kappa}B was analyzed by EMSA as described previously (52). In brief, the nuclear extracts of DT40 cells (2 x 106) treated with 10 µg/ml M4 were purified, incubated with a specific probe for the NF-{kappa}B DNA binding site (5'-CAACGGCAGGGGAATTCCCCTCTCCTT-3'), electrophoresed, and visualized by autoradiography.

In vitro kinase assay.
For IKK and TAK1 kinase assays, 2 x 107 DT40 cells stimulated with 10 µg/ml M4 were lysed in 1% NP-40 lysis buffer. Precleared lysates were immunoprecipitated by 1 µg anti-IKK{gamma} mAb or 1 µg anti-Flag mAb, followed by incubating with 40 µl of protein G-sepharose. The beads were washed three times with lysis buffer and two times with kinase buffer (25 mM Tris, pH 7.5, 5 mM ß-glycerolphosphate, 2 mM DTT, 0.1 mM Na3VO4, 10 mM MgCl2). Immunoprecipitates were resuspended in kinase buffer containing 100 µM ATP. GST-I{kappa}B{alpha} (NH2-terminal of mouse I{kappa}B{alpha}; amino acids 1–72) or GST-IKKß (activation loop of human IKKß; DLGYAKELDQGSLCTSFVGTLQYLAPELLEQQ or its mutant; DLGYAKELDQGALCTAFVGTLQYLAPELLEQQ) fusion protein (0.2 µg each) was added as a substrate for IKK or TAK1, respectively. After 30 min incubation at 30°C, the reaction was terminated by addition of SDS sample buffer followed by boiling for 5 min. The samples were separated by SDS-PAGE gel, transferred to PVDF membrane, and detected by anti–phospho-I{kappa}B{alpha} mAb or anti–phospho-IKK{alpha}/ß respectively. For JNK kinase assay, JNK kinase assay kit (Cell Signaling Technology Inc.) was used according to the manufacturer's instructions.

Flow cytometric analysis
Cell surface expression of BCR on various mutant DT40 cells was analyzed by FACSCalibur (Becton Dickinson) using anti–chicken IgM Ab (Bethyl) conjugated with allophycocyanin (Dojindo).

Online supplemental material.
Fig. S1 A shows protein expression in DT40 wild-type, TAK1-, PKCß-, and CARMA1-deficient DT40 B cells analyzed by Western blot. Fig. S1 (B and C) depicts cell surface expression of BCR on various mutant DT40 cells. Online supplemental material is available at http://www.jem.org/cgi/content/full/jem.20051591/DC1.


   Acknowledgments
 
We would like to thank our colleagues M. Kurosaki for expert technical assistance and M. Hikida for helpful advice.

This work was supported by grants to T. Kurosaki from the Ministry of Education, Science, Sports, and Culture in Japan and from Takeda Science Foundation.

The authors have no conflicting financial interests.

Submitted: 5 August 2005
Accepted: 13 September 2005


   References
 Top
 Abstract
 Results
 Discussion
 Materials and Methods
 References
 

  1. Kurosaki, T. 2002. Regulation of B-cell signal transduction by adaptor proteins. Nat. Rev. Immunol. 2:354–363.[CrossRef][Medline]
  2. Li, Q., and I.M. Verma. 2002. NF-{kappa}B regulation in the immune system. Nat. Rev. Immunol. 2:725–734.[CrossRef][Medline]
  3. Thome, M. 2004. CARMA1, BCL-10 and MALT1 in lymphocyte development and activation. Nat. Rev. Immunol. 4:348–359.[CrossRef][Medline]
  4. Ruland, J., and T.W. Mak. 2003. Transducing signals from antigen receptors to nuclear factor {kappa}B. Immunol. Rev. 193:93–100.[CrossRef][Medline]
  5. Ghosh, S., and M. Karin. 2002. Missing pieces in the NF-{kappa}B puzzle. Cell. 109:S81–S96.[CrossRef][Medline]
  6. Hayden, M.S., and S. Ghosh. 2004. Signaling to NF-{kappa}B. Genes Dev. 18:2195–2224.[Abstract/Free Full Text]
  7. Karin, M., and A. Lin. 2002. NF-{kappa}B at the crossroads of life and death. Nat. Immunol. 3:221–227.[CrossRef][Medline]
  8. Karin, M., and Y. Ben-Neriah. 2000. Phosphorylation meets ubiquitination: the control of NF-{kappa}B activity. Annu. Rev. Immunol. 18:621–663.[CrossRef][Medline]
  9. Guo, B., T.T. Su, and D.J. Rawlings. 2004. Protein kinase C family functions in B-cell activation. Curr. Opin. Immunol. 16:367–373.[CrossRef][Medline]
  10. Saijo, K., I. Mecklenbrauker, A. Santana, M. Leitger, C. Schmedt, and A. Tarakhovsky. 2002. Protein kinase C ß controls nuclear factor {kappa}B activation in B cells through selective regulation of the I{kappa}B kinase {alpha}. J. Exp. Med. 195:1647–1652.[Abstract/Free Full Text]
  11. Su, T.T., B. Guo, Y. Kawakami, K. Sommer, K. Chae, L.A. Humphries, R.M. Kato, S. Kang, L. Patrone, R. Wall, et al. 2002. PKC-ß controls I{kappa}B kinase lipid raft recruitment and activation in response to BCR signaling. Nat. Immunol. 3:780–786.[Medline]
  12. Yamaguchi, K., K. Shirakabe, H. Shibuya, K. Irie, I. Oishi, N. Ueno, T. Taniguchi, E. Nishida, and K. Matsumoto. 1995. Identification of a member of the MAPKKK family as a potential mediator of TGF-ß signal transduction. Science. 270:2008–2011.[Abstract]
  13. Ninomiya-Tsuji, J., K. Kishimoto, A. Hiyama, J. Inoue, Z. Cao, and K. Matsumoto. 1999. The kinase TAK1 can activate the NIK-I {kappa}B as well as the MAP kinase cascade in the IL-1 signalling pathway. Nature. 398:252–256.[CrossRef][Medline]
  14. Takaesu, G., R.M. Surabhi, K.J. Park, J. Ninomiya-Tsuji, K. Matsumoto, and R.B. Gaynor. 2003. TAK1 is critical for I{kappa}B kinase-mediated activation of the NF-{kappa}B pathway. J. Mol. Biol. 326:105–115.[CrossRef][Medline]
  15. Park, J.M., H. Brady, M.G. Ruocco, H. Sun, D. Williams, S.J. Lee, T. Kato Jr., N. Richards, K. Chan, F. Mercurio, et al. 2004. Targeting of TAK1 by the NF-{kappa}B protein Relish regulates the JNK-mediated immune response in Drosophila. Genes Dev. 18:584–594.[Abstract/Free Full Text]
  16. Silverman, N., R. Zhou, R.L. Erlich, M. Hunter, E. Bernstein, D. Schneider, and T. Maniatis. 2003. Immune activation of NF-{kappa}B and JNK requires Drosophila TAK1. J. Biol. Chem. 278:48928–48934.[Abstract/Free Full Text]
  17. Jiang, Z., J. Ninomiya-Tsuji, Y. Qian, K. Matsumoto, and X. Li. 2002. Interleukin-1 (IL-1) receptor-associated kinase-dependent IL-1-induced signaling complexes phosphorylate TAK1 and TAB2 at the plasma membrane and activate TAK1 in the cytosol. Mol. Cell. Biol. 22:7158–7167.[Abstract/Free Full Text]
  18. Sakurai, H., H. Miyoshi, W. Toriumi, and T. Sugita. 1999. Functional interactions of transforming growth factor ß-activated kinase 1 with I{kappa}B kinases to stimulate NF-{kappa}B activation. J. Biol. Chem. 274:10641–10648.[Abstract/Free Full Text]
  19. Sakurai, H., N. Shigemori, K. Hasegawa, and T. Sugita. 1998. TGF-ß-activated kinase 1 stimulates NF-{kappa}B activation by an NF-{kappa}B-inducing kinase-independent mechanism. Biochem. Biophys. Res. Commun. 243:545–549.[CrossRef][Medline]
  20. Lin, X., and D. Wang. 2004. The roles of CARMA1, Bcl10, and MALT1 in antigen receptor signaling. Semin. Immunol. 16:429–435.[CrossRef][Medline]
  21. Egawa, T., B. Albrecht, B. Favier, M.J. Sunshine, K. Mirchandani, W. O'Brien, M. Thome, and D.R. Littman. 2003. Requirement for CARMA1 in antigen receptor-induced NF-{kappa}B activation and lymphocyte proliferation. Curr. Biol. 13:1252–1258.[CrossRef][Medline]
  22. Hara, H., T. Wada, C. Bakal, I. Kozieradzki, S. Suzuki, N. Suzuki, M. Nghiem, E.K. Griffiths, C. Krawczyk, B. Bauer, et al. 2003. The MAGUK family protein CARD11 is essential for lymphocyte activation. Immunity. 18:763–775.[CrossRef][Medline]
  23. Jun, J.E., L.E. Wilson, C.G. Vinuesa, S. Lesage, M. Blery, L.A. Miosge, M.C. Cook, E.M. Kucharska, H. Hara, J.M. Penninger, et al. 2003. Identifying the MAGUK protein Carma-1 as a central regulator of humoral immune responses and atopy by genome-wide mouse mutagenesis. Immunity. 18:751–762.[CrossRef][Medline]
  24. Newton, K., and V.M. Dixit. 2003. Mice lacking the CARD of CARMA1 exhibit defective B lymphocyte development and impaired proliferation of their B and T lymphocytes. Curr. Biol. 13:1247–1251.[CrossRef][Medline]
  25. Ruefli-Brasse, A.A., D.M. French, and V.M. Dixit. 2003. Regulation of NF-{kappa}B-dependent lymphocyte activation and development by paracaspase. Science. 302:1581–1584.[Abstract/Free Full Text]
  26. Ruland, J., G.S. Duncan, A. Wakeham, and T.W. Mak. 2003. Differential requirement for Malt1 in T and B cell antigen receptor signaling. Immunity. 19:749–758.[CrossRef][Medline]
  27. Xue, L., S.W. Morris, C. Orihuela, E. Tuomanen, X. Cui, R. Wen, and D. Wang. 2003. Defective development and function of Bcl10-deficient follicular, marginal zone and B1 B cells. Nat. Immunol. 4:857–865.[CrossRef][Medline]
  28. Pomerantz, J.L., E.M. Denny, and D. Baltimore. 2002. CARD11 mediates factor-specific activation of NF-{kappa}B by the T cell receptor complex. EMBO J. 21:5184–5194.[Abstract/Free Full Text]
  29. Jun, J.E., and C.C. Goodnow. 2003. Scaffolding of antigen receptors for immunogenic versus tolerogenic signaling. Nat. Immunol. 4:1057–1064.[CrossRef][Medline]
  30. Gaide, O., B. Favier, D.F. Legler, D. Bonnet, B. Brissoni, S. Valitutti, C. Bron, J. Tschopp, and M. Thome. 2002. CARMA1 is a critical lipid raft-associated regulator of TCR-induced NF-{kappa}B activation. Nat. Immunol. 3:836–843.[CrossRef][Medline]
  31. Uren, A.G., K. O'Rourke, L.A. Aravind, M.T. Pisabarro, S. Seshagiri, E.V. Koonin, and V.M. Dixit. 2000. Identification of paracaspases and metacaspases: two ancient families of caspase-like proteins, one of which plays a key role in MALT lymphoma. Mol. Cell. 6:961–967.[Medline]
  32. Che, T., Y. You, D. Wang, M.J. Tanner, V.M. Dixit, and X. Lin. 2004. MALT1/paracaspase is a signaling component downstream of CARMA1 and mediates T cell receptor-induced NF-{kappa}B activation. J. Biol. Chem. 279:15870–15876.[Abstract/Free Full Text]
  33. Kanayama, A., R.B. Seth, L. Sun, C.K. Ea, M. Hong, A. Shaito, Y.H. Chiu, L. Deng, and Z.J. Chen. 2004. TAB2 and TAB3 activate the NF-{kappa}B pathway through binding to polyubiquitin chains. Mol. Cell. 15:535–548.[CrossRef][Medline]
  34. Sun, L., L. Deng, C.K. Ea, Z.P. Xia, and Z.J. Chen. 2004. The TRAF6 ubiquitin ligase and TAK1 kinase mediate IKK activation by BCL10 and MALT1 in T lymphocytes. Mol. Cell. 14:289–301.[CrossRef][Medline]
  35. Zhou, H., I. Wertz, K. O'Rourke, M. Ultsch, S. Seshagiri, M. Eby, W. Xiao, and V.M. Dixit. 2004. Bcl10 activates the NF-{kappa}B pathway through ubiquitination of NEMO. Nature. 427:167–171.[CrossRef][Medline]
  36. van Oers, N.S., and Z.J. Chen. 2005. Cell biology. Kinasing and clipping down the NF-{kappa}B trail. Science. 308:65–66.[Abstract/Free Full Text]
  37. Delhase, M., M. Hayakawa, Y. Chen, and M. Karin. 1999. Positive and negative regulation of I{kappa}B kinase activity through IKKß subunit phosphorylation. Science. 284:309–313.[Abstract/Free Full Text]
  38. Kishimoto, K., K. Matsumoto, and J. Ninomiya-Tsuji. 2000. TAK1 mitogen-activated protein kinase kinase kinase is activated by autophosphorylation within its activation loop. J. Biol. Chem. 275:7359–7364.[Abstract/Free Full Text]
  39. Singhirunnusorn, P., S. Suzuki, N. Kawasaki, I. Saiki, and H. Sakurai. 2005. Critical roles of threonine 187 phosphorylation in cellular stress-induced rapid and transient activation of transforming growth factor-ß-activated kinase 1 (TAK1) in a signaling complex containing TAK1-binding protein TAB1 and TAB2. J. Biol. Chem. 280:7359–7368.[Abstract/Free Full Text]
  40. Wang, D., R. Matsumoto, Y. You, T. Che, X.Y. Lin, S.L. Gaffen, and X. Lin. 2004. CD3/CD28 costimulation-induced NF-{kappa}B activation is mediated by recruitment of protein kinase C-{theta}, Bcl10, and I{kappa}B kinase ß to the immunological synapse through CARMA1. Mol. Cell. Biol. 24:164–171.[Abstract/Free Full Text]
  41. Takaesu, G., S. Kishida, A. Hiyama, K. Yamaguchi, H. Shibuya, K. Irie, J. Ninomiya-Tsuji, and K. Matsumoto. 2000. TAB2, a novel adaptor protein, mediates activation of TAK1 MAPKKK by linking TAK1 to TRAF6 in the IL-1 signal transduction pathway. Mol. Cell. 5:649–658.[CrossRef][Medline]
  42. Lee, K.Y., F. D'Acquisto, M.S. Hayden, J.H. Shim, and S. Ghosh. 2005. PDK1 nucleates T cell receptor-induced signaling complex for NF-{kappa}B activation. Science. 308:114–118.[Abstract/Free Full Text]
  43. Yaffe, M.B. 2002. MAGUK SH3 domains–swapped and stranded by their kinases? Structure (Camb). 10:3–5.[Medline]
  44. Tavares, G.A., E.H. Panepucci, and A.T. Brunger. 2001. Structural characterization of the intramolecular interaction between the SH3 and guanylate kinase domains of PSD-95. Mol. Cell. 8:1313–1325.[CrossRef][Medline]
  45. McGee, A.W., S.R. Dakoji, O. Olsen, D.S. Bredt, W.A. Lim, and K.E. Prehoda. 2001. Structure of the SH3-guanylate kinase module from PSD-95 suggests a mechanism for regulated assembly of MAGUK scaffolding proteins. Mol. Cell. 8:1291–1301.[CrossRef][Medline]
  46. Schaefer, B.C., J.W. Kappler, A. Kupfer, and P. Marrack. 2004. Complex and dynamic redistribution of NF-{kappa}B signaling intermediates in response to T cell receptor stimulation. Proc. Natl. Acad. Sci. USA. 101:1004–1009.[Abstract/Free Full Text]
  47. Wang, D., Y. You, S.M. Case, L.M. McAllister-Lucas, L. Wang, P.S. DiStefano, G. Nunez, J. Bertin, and X. Lin. 2002. A requirement for CARMA1 in TCR-induced NF-{kappa}B activation. Nat. Immunol. 3:830–835.[CrossRef][Medline]
  48. Moustakas, A., and C.H. Heldin. 2003. Ecsit-ement on the crossroads of Toll and BMP signal transduction. Genes Dev. 17:2855–2859.[Free Full Text]
  49. Mercurio, F., H. Zhu, B.W. Murray, A. Shevchenko, B.L. Bennett, J. Li, D.B. Young, M. Barbosa, M. Mann, A. Manning, and A. Rao. 1997. IKK-1 and IKK-2: cytokine-activated I{kappa}B kinases essential for NF-{kappa}B activation. Science. 278:860–866.[Abstract/Free Full Text]
  50. Ling, L., Z. Cao, and D.V. Goeddel. 1998. NF-{kappa}B-inducing kinase activates IKK-{alpha} by phosphorylation of Ser-176. Proc. Natl. Acad. Sci. USA. 95:3792–3797.[Abstract/Free Full Text]
  51. Oh-hora, M., S. Johmura, A. Hashimoto, M. Hikida, and T. Kurosaki. 2003. Requirement for Ras guanine nucleotide releasing protein 3 in coupling phospholipase C-{gamma}2 to Ras in B cell receptor signaling. J. Exp. Med. 198:1841–1851.[Abstract/Free Full Text]
  52. Shinohara, H., A. Inoue, N. Toyama-Sorimachi, Y. Nagai, T. Yasuda, H. Suzuki, R. Horai, Y. Iwakura, T. Yamamoto, H. Karasuyama, et al. 2005. Dok-1 and Dok-2 are negative regulators of lipopolysaccharide-induced signaling. J. Exp. Med. 201:333–339.[Abstract/Free Full Text]




This Article
Abstract
PDF (Full Text)
Supplemental Material Index
Alert me when this article is cited
Citation Map
Services
Alert me to new content in the JEM
Download to citation manager
Google Scholar
Articles by Shinohara, H.
Articles by Kurosaki, T.
PubMed
PubMed Citation
Articles by Shinohara, H.
Articles by Kurosaki, T.


  Home | Help | Feedback | Subscriptions | Archive | Search | Table of Contents