1 Department of Molecular and Cellular Biology, Baylor College of Medicine, One Baylor Plaza, Houston, TX 77030, USA
2 Department of Biological Chemistry, College of Medicine, University of California, Irvine, CA 92697, USA
3 Department of Molecular Biology and Genetics, Cornell University, Ithaca, NY 14853, USA
4 The Fox Chase Cancer Institute, Philadelphia, PA 19111, USA
5 Institute of Cell and Molecular Biology, University of Edinburgh, Edinburgh, EH9 3JR, UK
6 Department of Cell Biology, The Scripps Research Institute, La Jolla, CA 92037, USA
* Present address: Laboratory of Biosystems and Cancer, National Cancer Institute, National Institutes of Health, Bethesda, MD 20892, USA
Author for correspondence (e-mail: brinkley{at}bcm.tmc.edu)
Accepted June 20, 2001
![]() |
SUMMARY |
---|
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
---|
Key words: Centromere, Heterochromatin, Histones, Kinetochore, Mitosis
![]() |
INTRODUCTION |
---|
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
---|
The centromere proteins CENP-A and -C are each localized exclusively within the chromatin immediately beneath kinetochore plates (Saitoh et al., 1992; Warburton et al., 1997), and both are essential for growth and development in mammals (Fukagawa and Brown, 1997; Kalitsis et al., 1998; Howman et al., 2000). Microinjection experiments have suggested that these two proteins function specifically in the assembly of kinetochores. Microinjection of anti-CENP-A or -C antibodies into interphase cells blocked entry into or progression through mitosis, respectively, whereas microinjection of these antibodies after prophase did not inhibit the completion of mitosis (Tomkiel et al., 1994; Figueroa et al., 1998). The presence of CENP-A and -C exclusively at the active centromere of dicentric chromosomes and at human neocentromeres tightly correlates the presence of these proteins with kinetochore activity (Earnshaw et al., 1989; Warburton et al., 1997; Tyler-Smith et al., 1999; Saffery et al., 2000).
Based in part on similarities with the homologous yeast centromere proteins, Cse4p and Mif2p, CENP-A and -C have been proposed to form a nucleoprotein complex that stabilizes centromeric chromatin fibers and binds them to kinetochores (Meluh and Koshland, 1995; Meluh and Koshland, 1997; Stoler et al., 1995; Meluh et al., 1998; Sullivan, 1998). Genetic and biochemical studies suggest that CENP-A replaces histone H3 in centromere-specific nucleosomes (Palmer et al., 1991; Stoler et al., 1995; Smith et al., 1996; Meluh et al., 1998; Glowczewski et al., 2000; Yoda et al., 2000). CENP-C possesses a non-sequence-specific DNA binding activity and might act as a centromere-specific linker histone that stabilizes the linkage between centromeric DNA and nucleosomes containing CENP-A (Lanini and McKeon, 1995; Yang et al., 1996; Sullivan, 1998). The discovery of centromere-specific histones also in worms, flies and fission yeast suggest that the specialization of nucleosome structure is a common mechanism for kinetochore formation in divergent organisms (Buchwitz et al., 1999; Henikoff et al., 2000; Takahashi et al., 2000).
To determine if CENP-A is sufficient for kinetochore formation, we experimentally induced it to be mistargeted to non-centromeric regions of chromatin in order to determine if its misplacement subsequently caused the redistribution of various associated centromere-kinetochore components. Exogenous CENP-A is faithfully targeted to centromeres when expressed at near physiologic levels (Sullivan et al., 1994; Shelby et al., 1997). However, higher levels of CENP-A expression result in its faulty incorporation into widely dispersed non-centromeric sites throughout interphase nuclei and along the arms of mitotic chromosomes. We have found that a specific subset of constitutive and facultative centromere-kinetochore components becomes mistargeted to non-centromeric sites along with CENP-A. Our results suggest that CENP-A binding to chromatin modifies nucleosomes to favor the deposition of other centromere-kinetochore proteins, thereby orchestrating the initial stages of centromere-kinetochore assembly.
![]() |
MATERIALS AND METHODS |
---|
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
---|
Cell cultures were transfected with DNA using lipofectamine PLUS reagent (Gibco). Cells 70% confluent in 10 cm dishes were transiently transfected with 2 µg of vector DNA in complex with 8 µl of PLUS reagent and 12 µl of lipofectamine reagent in antibiotic-free medium. Transfected cells were split the next day and harvested two days later, except where noted. A stable, inducible CHO cell line expressing an epitope-tagged version of CENP-A was established by co-transfecting CHO-AA8 Tet-Off cells with 40 µg of pUHD10.3-CAepi (Shelby et al., 1997) and 2 µg of pTK-Hyg (Clontech). Stable transformants were selected by growth in 0.4 mg/ml hygromycin over 4 weeks, then maintained with 0.1 mg/ml. Colonies arising from single cells were grown in 24-well trays and assayed for inducible CENP-A-(HA) expression by western blot.
Mitotic cells with unreplicated genomes (MUGs) were generated as originally described (Brinkley et al., 1988). CHO cells were arrested overnight in medium containing 2 mM hydroxyurea (HU; Sigma). Fresh medium containing 2 mM HU and 5 mM caffeine was then added with 250 ng/ml Colcemid (Gibco) to arrest MUGs as they entered mitosis.
For chromosome preparations, cultures were arrested in mitosis by incubation with 250 ng/ml Colcemid (Gibco) for 3-5 hours. Mitotic cells were selectively harvested by shake-off and swollen for 10 minutes at 37°C in 75 mM KCl containing 0.1 mM phenylmethylsulfonyl fluoride (PMSF). The cells were then cytospun onto glass coverslips using a Cytospin 3 (Shandon Instruments, Inc., Pittsburgh, PA) at 2000 rpm for 2 minutes. and processed for immunofluorescence as described below.
Expression constructs
The full-length CENP-A expression construct used in this study has been described previously (Shelby et al., 1997). This construct, pUHD10.3-CAepi, contains three copies of the hemagglutinin 1 (HA-1) epitope (Niman et al., 1983) at the C-terminus of the human CENP-A cDNA and is based on the tetracycline-repressible construct described previously (Gossen and Bujard, 1992). A deletion mutant of this construct, which we refer to as CENP-A-core, was generated by amplifying the entire pUHD10.3-CAepi plasmid, less the nucleotides encoding the N-terminal amino acids 2-45 of CENP-A. The following oligonucleotide primers were used for PCR, in combination with pUHD10.3-CAepi as the template: 5'-atcgaaccatgggttggctaaaggagatccgaaagc; and 3'-atcgaaccatggcacgccgcagag. The product was digested with the restriction enzyme NcoI, the sites for which were introduced in the primer sequences, and then ligated to form a circular DNA. Sequencing of the construct confirmed the desired product, and expression was assessed by western analysis and immunofluorescence microscopy following transfection into HeLa Tet-On cells. The amino-acid sequence of the HA-tagged CENP-A protein is as follows, with the excised residues underlined and the epitope-tag in italics: MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLGGRIFYPYDVPDYAGYPYDVPDYAGSYPYDVPDYAAQCGR.
To accomplish tetracycline-regulated ectopic expression of CENP-C in HeLa Tet-On and CHO Tet-Off cells, a human CENP-C cDNA (Saitoh et al., 1992) was sub-cloned from pBluescript (Stratagene, La Jolla, CA) into pTRE (Clontech) using flanking BamHI and HindIII sites. The desired product was confirmed by DNA sequence analysis and immunofluorescence microscopy.
Immunofluorescence microscopy
As previously described in detail (Van Hooser and Brinkley, 1999), cells on coverslips were first rinsed with PBS, and then soluble proteins were extracted with 0.5% Triton X-100 (TX-100) in PEM (80 mM K-Pipes, pH 6.8, 5 mM EGTA, pH 7.0, 2 mM MgCl2) for 2 minutes at 4°C prior to fixing with 4% formaldehyde (Polysciences Inc., Warrington, PA) in PEM for 20 minutes at 4°C. Nonspecific binding of antibodies was blocked overnight at 4°C with 5% milk in TBST (20 mM Tris-HCl, pH 7.6, 137 mM NaCl, 0.1% Tween 20). Primary antisera were diluted in TBST and incubated on coverslips for 1 hour at 37°C. Human auto-antiserum SH-CREST (Valdivia and Brinkley, 1985) was diluted 1:1000 for immunofluorescence. Monoclonal antibody HA.11 (BAbCO, Richmond, CA) was diluted to 2 µg/ml, rabbit anti-hSMC1 1:100 (Schmiesing et al., 1998), rabbit anti-HZW10 1:250 (Starr et al., 1997), rat anti-HZwint-1 1:250 (Starr et al., 2000), rabbit and murine monoclonal anti-CENP-B 1:250 (Cooke et al., 1990), rabbit anti-CENP-C 1:250 (Saitoh et al., 1992), murine monoclonal anti-CENP-E IgG 1:500 (Yen et al., 1991), rabbit anti-CENP-F (BAbCO) to 2 µg/ml, and rabbit anti-phosphorylated (Ser10) H3 (Upstate Biotechnology, Lake Placid, NY) to 0.2 µg/ml (Hendzel et al., 1997). Goat anti-human, anti-rabbit, anti-rat, and anti-mouse IgG (H+L) secondary antibodies (Jackson Immunoresearch Laboratories Inc., West Grove, PA), conjugated to FITC or TXRD, were diluted in TBST and incubated with samples for 45 minutes at 37°C. DNA was counterstained with 0.1 µg/ml 4',6-diamidino-2-phenylindole (DAPI) in TBST. Coverslips were mounted on glass slides using Vectashield anti-fade medium (Vector Laboratories Inc., Burlingame, CA). All figures are composite images obtained with a Deltavision, deconvolution-based optical workstation (Applied Precision, Issaquah, WA). Z-series stacks of multiple focal planes were used to render 3D volumes.
Nuclear matrix preparation
Chromatin was eluted from cells fixed in formaldehyde, as described (Nickerson et al., 1997). Cells growing on coverslips were washed in cold PBS, and soluble proteins were extracted for 5 minutes at 4°C in CSK (10 mM K-Pipes, pH 6.8, 0.3 M sucrose, 0.1 M NaCl, 3 mM MgCl2, 1 mM EGTA, 20 mM vanadyl riboside complex (VRC), 1 mM PMSF; 1 µg/ml each of aprotinin, leupeptin, antipain, and pepstatin) containing 0.5% TX-100. Preparations were fixed with 4% formaldehyde in CSK for 20 minutes at 4°C, rinsed in CSK twice, and once in DIG (10 mM K-Pipes, pH 6.8, 0.3 M sucrose, 50 mM NaCl, 3 mM MgCl2, 1 mM EGTA). Chromatin was removed by digestion with 400 units/ml RNase-free DNase I (Roche Molecular Biochemicals, Indianapolis, IN) in DIG for 50 minutes at 32°C. The preparations were washed briefly with 0.25 M ammonium sulfate in DIG, then in DIG and CSK alone prior to immunostaining.
Immunoblotting
Cells were harvested from culture flasks using 0.03% EDTA in Pucks saline and pelleted at 1000 g for 6 minutes. Cell pellets were resuspended in 1x SDS-PAGE sample buffer for whole-cell preparations (Laemmli, 1970). For nuclear extracts, cell pellets were resuspended in PEM containing 0.5% TX-100 and multiple protease inhibitors, and then incubated on ice for 20 minutes. The extracted cells were pelleted for 10 minutes at 1000 g at 4°C and resuspended in 1x SDS-PAGE sample buffer. Protein samples were heated at 95°C for 5 minutes and resolved by electrophoresis on 4-20% gradient gels (BioRad Laboratories, Hercules, CA) for 2.5 hours at 120 V. Proteins were transferred to polyvinylidene fluoride microporous membranes (Millipore Corporation, Bedford, MA) overnight at 50 mA in an electroblotting apparatus (BioRad). Filters were blocked with 5% milk in TBST for 90 minutes at room temperature (RT) and rinsed briefly in TBST. Primary antibodies were diluted in TBST and incubated with filters for 1 hour at 37°C. SH-CREST auto-antiserum was diluted 1:2000 for immunoblotting. Monoclonal antibody HA.11 (BAbCO) was diluted to 1 µg/ml, rabbit anti-hSMC1 1:2000 (Schmiesing et al., 1998), and rabbit anti-CENP-C 1:1000 (Saitoh et al., 1992). Filters were washed in TBST and incubated with alkaline-phosphatase-coupled goat anti-IgG (H+L) secondary antibodies (Pierce, Rockford, IL) diluted 1:2500 in TBST for 1 hour at RT. The filters were rinsed in TBST and AP buffer (100 mM NaCl, 5 mM MgCl2, 100 mM Tris-HCl, pH 9.5), then reacted with BCIP/NBT (Sigma) for 5-60 minutes at RT.
![]() |
RESULTS |
---|
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
---|
|
|
|
|
|
|
|
|
|
|
|
|
|
CENP-A recruits CENP-C to non-centromeric chromatin
CENP-C is a constitutive centromere protein that is essential for the faithful transmission of chromosomes to daughter cells during mitosis (Tomkiel et al., 1994; Fukagawa and Brown, 1997; Kalitsis et al., 1998). CENP-C is normally localized with CENP-A exclusively within the centromeric heterochromatin directly beneath kinetochores (Fig. 3) (Saitoh et al., 1992). However, when CENP-A was overexpressed in cells, we found that CENP-C colocalized with the mistargeted CENP-A at ectopic regions along the lengths of mitotic chromosomes. Untransfected cells on the same coverslips demonstrated the characteristic centromere-specific staining of anti-CENP-C antibody (Fig. 3). Interphase chromatin also showed non-centromeric staining of CENP-C when CENP-A was overexpressed and mistargeted in the cells (see below).
The mistargeting of CENP-C that was induced by CENP-A overexpression was confirmed by two lines of experimentation, both using human autoimmune sera. First, we took advantage of the previous finding that two of the three centromere proteins recognized by SH-CREST antiserum are nuclear matrix antigens: CENP-B and CENP-C (Ouspenski and Brinkley, 1993; He and Brinkley, 1996). CENP-A is also recognized by the serum, but can be eluted from cell preparations with other histones by DNase and high salt treatments (Ouspenski and Brinkley, 1993; He and Brinkley, 1996). We found that CENP-A could be eluted from the chromatin of overexpressing cells, yet SH-CREST staining remained at non-centromeric and centromeric sites, indicating the presence of CENP-B and/or -C (Fig. 4). Given that the localization of CENP-B was found to be unchanged by CENP-A overexpression using specific sera, the above result confirms that CENP-C is recruited to non-centromeric regions of chromatin containing mistargeted CENP-A.
A second experimental approach used a CREST autoimmune serum, designated EK (Mole-Bajer et al., 1990), which recognizes CENP-B and CENP-C, but not CENP-A, by western. Although EK-CREST staining is normally restricted to centromeres in HeLa and CHO cells, non-centromeric staining was observed when CENP-A was overexpressed (data not shown).
CENP-C does not recruit CENP-A to non-centromeric chromatin
To determine if the opposite reaction is also possible, we induced CENP-C to be mistargeted through its overexpression and examined the subsequent localization of CENP-A. It has previously been shown (Fukagawa et al., 1999) that excess CENP-C associates with chromosomes during early mitosis when overexpressed in the chicken DT40 cell line, is redistributed into perichromosomal foci during late mitosis, and then forms nuclear inclusions during interphase. In HeLa cells, we found that overexpressed CENP-C showed a pattern of mistargeting similar to that of CENP-A, characterized by high levels at centromeres and lower levels throughout the interphase euchromatin (Fig. 5). Despite the mistargeting of CENP-C during interphase, CENP-A was faithfully targeted to centromeres (Fig. 5). HeLa cell growth was potently inhibited by CENP-C overexpression, and mitotic cells were not observed.
Mechanism of CENP-A-induced mistargeting
In cells overexpressing CENP-A, the mistargeting of CENP-C could be due to the recruitment of CENP-C to non-centromeric chromatin by CENP-A, or possibly due to an increase in CENP-C expression induced by excess CENP-A. To investigate this point, the amount of CENP-C protein was compared by western analysis between CHO cells induced to express exogenous CENP-A over 50+ passages and the same cell line uninduced over the same number of passages. The total level of CENP-C protein in cells appeared equal in the presence and absence of CENP-A overexpression (Fig. 6). The amount of CENP-B in cells was also observed to be equivalent between the two samples, as was expected given the lack of CENP-B association with non-centromeric sites of CENP-A targeting (Fig. 6). The amount of CENP-C protein associated with the chromatin also appeared to be equal in the presence and absence of CENP-A overexpression (Fig. 6). These results suggest that endogenous CENP-C is recruited away from centromeres to regions of the chromosome containing mistargeted CENP-A.
Recruitment of CENP-C requires the CENP-A tail
The homology between CENP-A and H3 resides exclusively in the C-terminal globular core domain of the two histones, whereas the N-terminal tails of the two histones, exposed at the surface of nucleosomes, share little homology (Sullivan et al., 1994). We therefore sought to determine if the unique tail of CENP-A was required for recruitment of CENP-C to ectopic regions of chromatin. The expression vector used in the above experiments was modified to remove the sequence encoding amino acids 2-45 of CENP-A N-terminus (see Materials and Methods). This resulted in an identical complement of transcriptional and translational control elements, but expressing a tailless CENP-A peptide. We found that the N-terminal 44 amino acids of CENP-A are not required for its targeting to centromeres (Fig. 7), similar to results obtained previously (Sullivan et al., 1994). Lower levels of non-centromeric targeting upon overexpression were also observed, identical to the full-length CENP-A molecule (Fig. 7). However, we found that CENP-C was not recruited to non-centromeric regions when the CENP-A tail was missing (Fig. 7) (Table 1).
CENP-A assembles kinetochore components on chromatin
It was recently discovered that the human structural maintenance of chromosomes protein 1 (hSMC1) is localized to centromeres-kinetochores from early prophase to late anaphase (H.C.G. and K.Y., unpublished). The heterodimeric hSMC1/hSMC3 complex appears to be involved in chromosome alignment and metaphase progression in human cells (Schmiesing et al., 1998). We found that when CENP-A was overexpressed in HeLa and CHO cells, anti-hSMC1 antibody predominately stained kinetochores during mitosis, but some staining was also colocalized with mistargeted CENP-A along the lengths of chromosomes (Fig. 8). In untransfected cells within the same preparations, anti-hSMC1 stained exclusively the kinetochores (Fig. 8A). Mistargeting of hSMC1 to chromosome arms was observed between early prophase and late anaphase, displaying similar dynamics to the faithfully targeted hSMC1 protein at kinetochores (Fig. 8B,C). During interphase, hSMC1 is targeted to nuclear matrix foci that do not correspond to prekinetochores. This pattern appeared unchanged by the overexpression and mistargeting of CENP-A (data not shown). The total level of hSMC1 protein in cells and associated with chromatin appeared the same in the presence and absence of CENP-A overexpression (Fig. 6). hSMC1 was not recruited to non-centromeric sites when the CENP-A core domain alone was mistargeted (data not shown), indicating that the CENP-A tail is required for recruiting hSMC1 to ectopic sites, identical to the results found for CENP-C recruitment (Fig. 7). The overexpression and mistargeting of CENP-C was not sufficient to recruit hSMC1 to non-centromeric regions (data not shown; Table 1).
HZwint-1 (human ZW10 interacting protein 1) localizes to kinetochores from prophase to late anaphase (Starr et al., 2000). We found that HZwint-1 was mislocalized along the lengths of mitotic chromosomes together with mistargeted CENP-A (Fig. 9A). Interestingly, HZwint-1 colocalized with CENP-A throughout interphase chromatin as well, but was not as predominant at centromeres-prekinetochores (Fig. 9B). HZwint-1 is normally cytoplasmic during interphase (Starr et al., 2000), as was observed in untransfected cells within the same preparation (Fig. 9B). Cells in which CENP-C was overexpressed, rather than CENP-A, did not show the same redistribution of HZwint-1 to non-centromeric regions of interphase chromatin (Fig. 9C). HZwint-1 was not recruited to non-centromeric sites when the CENP-A core domain alone was mistargeted (data not shown), indicating that the CENP-A tail is required for recruiting HZwint-1 to ectopic sites.
Microtubule-associated proteins are not assembled by CENP-A
The kinetochore component ZW10 is necessary to recruit the microtubule-associated motor dynein to kinetochores and is essential for proper chromosome segregation in Drosophila (Williams et al., 1992; Starr et al., 1998). ZW10 is localized to kinetochores from prometaphase through anaphase and is distributed along kinetochore microtubules during metaphase (Williams et al., 1992). We found that the human homologue, HZW10 (Starr et al., 1997), remained at kinetochores when CENP-A was mistargeted to chromosome arms (Fig. 10A).
CENP-E is a kinesin-related mitotic motor protein, localized to kinetochores from prometaphase through anaphase (Yen et al., 1991; Yen et al., 1992; Cooke et al., 1997). CENP-E was also not recruited to the arms of chromosomes along with mistargeted CENP-A (Fig. 10B).
CENP-A-directed chromatin assembly is not sufficient for neocentric activity
The stable CHO and HeLa cell lines used in this study display similar growth rates over multiple passages whether expression of ectopic CENP-A is induced or uninduced (data not shown). The apparent lack of mitotic defects in these cells suggests that mistargeting of CENP-A does not significantly alter the normal pattern of chromosome segregation. Electron microscopy demonstrated the presence of trilaminar kinetochore plates and spindle microtubules at the primary constriction only and not elsewhere along the chromosomes in these cells (data not shown).
To further determine if CENP-A is sufficient for kinetochore assembly and function, we tested the capacity of individual non-centromeric chromosome fragments containing CENP-A for mitotic movement in mitotic cells with unreplicated genomes (MUGs). With the MUG procedure, caffeine is used to induce premature entry into mitosis and chromosome fragmentation in cells arrested at the G1/S-phase boundary (Brinkley et al., 1988; Zinkowski et al., 1991; Ouspenski and Brinkley, 1993). Under these conditions, fragments of the centromere-kinetochore disassociate from chromosome arms and align on the metaphase plate, whereas non-centromeric chromosome fragments are displaced from the spindle and segregate randomly. We found that mistargeted CENP-A did not support the movement of arm-derived chromosome fragments in this system, as would have been expected if mistargeted CENP-A had conferred neocentromeric activity to chromosome arms (Fig. 11A). The only fragments that appeared capable of aligning on the metaphase plate were those that stained very intensely with SH-CREST antibody and thus corresponded to true centromere-kinetochore fragments, as shown previously by EM (Fig. 11A) (Zinkowski et al., 1991).
We hypothesized that the native centromere on chromosomes might be suppressing the formation of kinetochores at distal sites where CENP-A was experimentally mistargeted. Evidence that such a mechanism exists comes mostly from the study of dicentric chromosomes, in which one centromere is, in most cases, inactivated, thereby stabilizing the chromosome during cell division (Karpen and Allshire, 1997; Wiens and Sorger, 1998). Similarly, neocentromeres can form on fly and human chromosomes within regions of DNA that previously did not display centromere activity (Karpen and Allshire, 1997; Choo, 2000). Thus, mechanisms must exist to suppress this neocentromeric activity when an endogenous centromere is functioning at a different position on the same chromosome (Karpen and Allshire, 1997).
To determine if CENP-A has the capacity to form complete kinetochores at ectopic sites in the absence of any suppressive effect caused by the endogenous centromere on the same chromosome, we mistargeted CENP-A to double-minute (DM) chromosomes, which lack centromeres in most cases. For these experiments, a human colorectal carcinoma cell line, COLO 320DM, was used that contains DMs in >24% of the metaphases. We found that the mistargeting of CENP-A to DMs resulted in a protein complex similar to that formed along the lengths of normal chromosomes. As discussed above, this complex contained CENP-A, CENP-C, hSMC1 and HZwint-1, but did not contain the microtubule-associated kinetochore proteins ZW10 and CENP-E (Fig. 11; and data not shown). These results indicate that factor(s) unique to the centromere locus are required in addition to CENP-A for the assembly of kinetochore microtubule-associated factors. These results also suggest that centromere-kinetochore factors are not spread along chromosomes from endogenous centromeres when CENP-A is mistargeted, but appear to be recruited de novo to non-centromeric regions.
CENP-A function on dicentric chromosomes
Active centromeres on dicentric chromosomes are defined as the locus at which kinetochores are formed and as the final point of sister chromatid cohesion prior to anaphase onset (Vig and Rattner, 1989). Inactive centromeres do not form kinetochores and separate earlier in mitosis with the chromosome arms. Both active and inactive centromeres can be detected by immunostaining with CREST antiserum, due to the presence of CENP-B at both sites (Merry et al., 1985; Earnshaw et al., 1989), although all other known centromere and kinetochore proteins are limited to the active centromere only (Sullivan and Schwartz, 1995; Warburton et al., 1997; Faulkner et al., 1998; Starr et al., 2000). We found that when exogenous CENP-A was overexpressed in the COLO 320DM cell line, which contains several dicentric chromosomes, active centromeres were the preferential site of CENP-A targeting (Fig. 12A). Similar results have been reported for the distribution of endogenous CENP-A on a dicentric chromosome (Warburton et al., 1997). We have confirmed that CENP-C, HZwint-1 and hSMC1 are all targeted exclusively to the active centromere of dicentric chromosomes along with CENP-A (data not shown) (Earnshaw et al., 1989; Starr et al., 2000) (H.C.G. and K.Y., unpublished). This data is consistent with a central role for CENP-A in assembling these factors to form kinetochore-specific chromatin.
Potentially, the occlusion of CENP-A from chromatin could be a mechanism for inactivating extra centromeres when fusion events produce a chromosome with more than one centromere. To experimentally test this hypothesis, we examined the distribution of kinetochore components on dicentric chromosomes following the mistargeting of CENP-A to inactive centromeres. At high levels of ectopic expression, CENP-A was observed to target the lengths dicentric chromosomes, including inactive centromeres (Fig. 12A; and data not shown). CENP-A appeared to target these regions with a reduced efficiency relative to the active centromeres. We found that the partial centromere-prekinetochore complex recruited by CENP-A to inactive centromeres resembled that formed along the chromosome arms: containing CENP-A, CENP-C, hSMC1 and HZwint-1, as discussed above. The complex formed at inactive centromeres lacked HZW10 and CENP-E, resembling the chromosome arms rather than the active centromere (Fig. 12B). Thus, CENP-A is not sufficient to restore activity to inactive centromeres, and the control of CENP-A targeting is not the only element regulating centromere activity on multicentric chromosomes.
![]() |
DISCUSSION |
---|
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
---|
CENP-A-containing chromatin further assembled the kinetochore components hSMC1 and HZwint-1 at non-centromeric sites. In addition, another facultative kinetochore protein CENP-F was observed in some cases, at very low levels, to mistarget to non-centromeric sites with CENP-A and its associated factors (data not shown). The kinetochore proteins that were recruited by CENP-A share commonalties in their timing of localization to kinetochores and in their protein structure that make them distinct from other kinetochore components. First, these factors arrive at prekinetochores before microtubule-associated factors and remain longer. Specifically, hSMC1, HZwint-1 and CENP-F localize to prekinetochores between G2 and early prophase and remain until telophase (Rattner et al., 1993; Liao et al., 1995; Starr et al., 2000) (H.C.G. and K.Y., unpublished). The microtubule-associated factors CENP-E and ZW10, which were not recruited to ectopic regions with CENP-A, are targeted to kinetochores later, during prometaphase, and appear in some cases to redistribute down spindle microtubules at metaphase (Yen et al., 1991; Williams et al., 1992). A second feature shared by hSMC1, and HZwint-1, and CENP-F is the presence of extensive coiled coil forming domains in their protein structure (Rattner et al., 1993; Liao et al., 1995; Odgren et al., 1996; Schmiesing et al., 1998; Starr et al., 2000). Interactions between coiled coil-containing proteins are thought perhaps to play a scaffolding role during kinetochore assembly by allowing the formation of fibrous structures or protein-protein binding sites that target other kinetochore components (Liao et al., 1995; Starr et al., 2000). It therefore appears that CENP-A is sufficient to assemble, at least in part, a centromere and a prekinetochore scaffold.
The ability of CENP-A to assemble into chromatin and recruit other centromere-prekinetochore components appears to be a unique property of this histone. Overexpression of other centromere-kinetochore proteins discussed in this study resulted in their aberrant accumulation in the cytoplasm or nucleus and/or was toxic to cells (data not shown). CENP-C alone displayed a similar association with interphase chromatin as CENP-A did when overexpressed, although CENP-C did not assemble the same centromere-prekinetochore complex. Our results are consistent with those of Fukagawa et al., who demonstrated that CENP-C alone, mislocalized by overexpression, did not recruit the dynein-associated kinetochore protein ZW10 to non-centromeric sites (Fukagawa et al., 1999). Similarly, we have shown that CENP-C in complex with other factors recruited by CENP-A is also not sufficient for assembling ZW10 or CENP-E to non-centromeric regions.
Centromeric association of the yeast cohesin complex, which is essential for sister chromatid cohesion, has been shown to require Cse4p and Mif2p, homologues of CENP-A and -C, respectively (Guacci et al., 1997; Michaelis et al., 1997; Tanaka et al., 1999). Our results demonstrate that in mammalian cells, CENP-A is sufficient for targeting the cohesin subunit hSMC1 to chromosomes during mitosis, but not during interphase. As CENP-C was mistargeted along with CENP-A, these factors could have recruited hSMC1 together. Mistargeting of CENP-C alone was not sufficient to recruit hSMC1 (data not shown). Although the function of hSMC1 at mammalian centromeres-kinetochores remains elusive, it is interesting to note that the targeting of this cohesin to chromosome arms did not detectably interfere with sister chromatid separation.
The centromere-prekinetochore scaffold assembled by CENP-A is not sufficient for complete centromere activity, indicating the presence of one or more additional steps in the kinetochore assembly pathway. Kinetochore plates were not observed by electron microscopy at non-centromeric sites of CENP-A localization, and neocentromeric activity was not detected by the MUG assay. CENP-A was also not sufficient for the assembly of complete kinetochores on acentric DM chromosomes. This experiment indicates that the lack of complete kinetochore assembly by CENP-A at non-centromeric regions was not due to cis-acting suppression by the endogenous centromere on the same chromosome. Rather, the endogenous centromere appears to contain information in addition to CENP-A that is specifically required for the targeting of microtubule-associated factors and assembly of kinetochore plates on chromosomes.
CENP-A was similarly not sufficient for the complete assembly of kinetochores when experimentally targeted to the inactive centromeres of dicentric chromosomes. These inactive centromeres, like active centromeres on the same chromosome, contain alpha-satellite DNA, low levels of histone acetylation, and are late replicating (A.A.V.H., I.I.O. and B.R.B., unpublished). Thus, the determinants unique to active centromeres that are required in addition to CENP-A for kinetochore formation must be distinct from these factors. A key step in defining the kinetochore locus might be the post-translational marking of the centromere proteins themselves and the transmittance of these mark(s) at the active centromere locus between cell generations (Everett et al., 1999). If centromere proteins are indeed marked, it would be of interest with regard to the above data to determine if this mark is retained when centromere proteins are experimentally mistargeted to non-centromeric regions.
CENP-A potentially could target other centromere-kinetochore components to chromatin through protein-protein interactions, or perhaps by modulating chromatin structure. Previous studies have suggested that the functional specialization of chromatin by histone variants is associated with changes in the protein-protein interactions that occur at the surface of nucleosomes between histone tails and non-histone proteins (Wolffe and Pruss, 1996). Biochemical and genetic data have shown an interaction between Cse4p and the Ctf19p-Mcm21p-Okp1p complex, which is potentially involved in kinetochore assembly and kinetochore-microtubule interactions (Ortiz et al., 1999; Chen et al., 2000). This interaction requires a specific, essential domain within the N-terminal tail of the histone (Keith et al., 1999; Chen, et al., 2000). We have found that the distinctive N-terminal tail of CENP-A is required for the recruitment of CENP-C and components of the prekinetochore scaffold to ectopic regions. As our experiments with the truncation mutant were conducted in a normal background containing endogenous CENP-A, they do not address whether the CENP-A tail is required for targeting these factors to their native centromere-kinetochore location.
A yeast two-hybrid screen using the CENP-A tail as bait has identified a number of proteins that putatively interact, but this set does not include the proteins discussed in the present study (I.I.O, A.A.V.H. and B.R.B., unpublished). Similarly, immunoprecipitation of detergent-soluble CENP-A from CHO cells did not reveal any interaction between this fraction of CENP-A and CENP-B, -C, or hSMC1 (data not shown). These data suggest that CENP-A is not in a complex with the other factors prior to their deposition at centromeres. Thus, we favor a model in which CENP-A recruits centromere-prekinetochore scaffold components to chromatin. A more detailed study including the isolation of CENP-A from chromatin without disruption of kinetochore structure would likely be required to establish a direct interaction, if any.
Alternative to a model in which this recruitment occurs by protein-protein interactions, a particular structural conformation may be given to the chromatin in which CENP-A is incorporated that favors the assembly of a centromere-prekinetochore scaffold. The amino acid sequence of CENP-A diverges from that of histone H3 at a number of N-terminal tail residues that are acetylated in transcriptionally active chromatin and phosphorylated during chromosome condensation (Sullivan et al., 1994; Van Hooser et al., 1999). Acetylation and phosphorylation of the H3 tail is thought to weaken its association with DNA and open chromatin, either directly by altering nucleosome structure, or indirectly by targeting specific nonhistone proteins (Van Hooser et al., 1999). CENP-A might confer a specific structure to nucleosomes within a subregion of the centromere and allow a higher-order state of chromatin to develop as a necessary precursor to kinetochore assembly (Meluh and Koshland, 1997; Van Hooser et al., 1999).
Based on the results reported here, we extend previously proposed models for mammalian kinetochore assembly. CENP-A targeting appears as an initial step in forming a kinetochore. The constitutive centromere protein CENP-C is recruited to nucleosomes containing CENP-A during interphase to form a nucleoprotein complex that structurally defines kinetochore-specific chromatin within extended regions of centromeric heterochromatin. Kinetochore assembly is insulated from the dynamics of interphase chromatin remodeling due to the presence of CENP-A and the subsequent reduction of nucleosome modifications associated with H3 in transcriptionally active chromatin (Meluh and Koshland, 1997; Van Hooser et al., 1999). As cells enter mitosis, subunits of centromeric heterochromatin containing the CENP-A/CENP-C nucleosome complex assemble to form a prekinetochore scaffold, composed of HZwint-1, hSMC1 and CENP-F, as a necessary precursor for kinetochore plate formation (Zinkowski et al., 1991). Targeting of microtubule motor-associated proteins to the prekinetochore scaffold is governed by additional factor(s) present only at the active centromere site, distinct from alpha-satellite DNA, patterns of histone hypoacetylation, and late DNA replication timing. CENP-A and/or CENP-C potentially carry unique patterns of post-translational modifications that (1) mark where the active locus is transmitted on chromosomes between cell generations, and (2) are required for kinetochore plate assembly and microtubule attachment (Everett et al., 1999; Choo, 2000). The principal role of the CENP-A nucleoprotein complex during mitosis may be to maintain the conformation of chromatin beneath kinetochores as mechanical stress is applied to centromeres (Sullivan, 1998).
![]() |
ACKNOWLEDGMENTS |
---|
![]() |
REFERENCES |
---|
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
---|
Brinkley, B. R. and Stubblefield, E. (1966). The fine structure of the kinetochore of a mammalian cell in vitro. Chromosoma 19, 28-43.[Medline]
Brinkley, B. R., Zinkowski, R. P., Mollon, W. L., Davis, F. M., Pisegna, M. A., Pershouse, M. and Rao, P. N. (1988). Movement and segregation of kinetochores experimentally detached from mammalian chromosomes. Nature 336, 251-254.[Medline]
Buchwitz, B. J., Ahmad, K., Moore, L. L., Roth, M. B. and Henikoff, S. (1999). A histone-H3-like protein in C. elegans. Nature 401, 547-548.[Medline]
Chen, Y., Baker, R. E., Keith, K. C., Harris, K., Stoler, S. and Fitzgerald-Hayes, M. (2000). The N terminus of the centromere H3-like protein Cse4p performs an essential function distinct from that of the histone fold domain. Mol. Cell. Biol. 20, 7037-7048.
Choo, K. H. A. (2000). Centromerization. Trends Cell. Biol. 10, 182-188.[Medline]
Clarke, L. (1998). Centromeres: proteins, protein complexes, and repeated domains at centromeres of simple eukaryotes. Curr. Opin. Genet. Dev. 8, 212-218.[Medline]
Cooke, C. A., Bernat, R. L. and Earnshaw, W. C. (1990). CENP-B: A major human centromere protein located beneath the kinetochore. J. Cell Biol. 110, 1475-1488.[Abstract]
Cooke, C. A., Schaar, B., Yen, T. J. and Earnshaw, W. C. (1997). Localization of CENP-E in the fibrous corona and outer plate of mammalian kinetochores from prometaphase through anaphase. Chromosoma 106, 446-455.[Medline]
Craig, J. M., Earnshaw, W. C. and Vagnarelli, P. (1999). Mammalian centromeres: DNA sequence, protein composition, and role in cell cycle progression. Exp. Cell Res. 246, 249-262.[Medline]
Csink, A. K. and Henikoff, S. (1998). Something from nothing: the evolution and utility of satellite repeats. Trends Genet. 14, 200-204.[Medline]
Earnshaw, W. C. and Rothfield, N. F. (1985). Identification of a family of three related centromere proteins using autoimmune sera from patients with scleroderma. Chromosoma 91, 313-321.[Medline]
Earnshaw, W. C., Ratrie, H., 3rd, Stetten, G. (1989). Visualization of centromere proteins CENP-B and CENP-C on a stable dicentric chromosome in cytological spreads. Chromosoma 98, 1-12.[Medline]
Everett, R. D., Earnshaw, W. C., Findlay, J. and Lomonte, P. (1999). Specific destruction of kinetochore protein CENP-C and disruption of cell division by herpes simplex virus immediate-early protein Vmw110. EMBO J. 18, 1526-1538.
Faulkner, N. E., Vig, B., Echeverri, C. J., Wordeman, L. and Vallee, R. B. (1998). Localization of motor-related proteins and associated complexes to active, but not inactive, centromeres. Hum. Mol. Genet. 7, 671-677.
Figueroa, J., Saffrich, R., Ansorge, W. and Valdivia, M. (1998). Microinjection of antibodies to centromere protein CENP-A arrests cells in interphase but does not prevent mitosis. Chromosoma 107, 397-405.[Medline]
Fukagawa, T. and Brown, W. R. A. (1997). Efficient conditional mutation of the vertebrate CENP-C gene. Hum. Mol. Genet. 6, 2301-2308.
Fukagawa, T., Pendon, C., Morris, J. and Brown, W. (1999). CENP-C is necessary but not sufficient to induce formation of a functional centromere. EMBO J. 18, 4196-4209.
Glowczewski, L., Yang, P., Kalashnikova, T., Santisteban, M. S. and Smith, M. M. (2000). Histone-histone interactions and centromere function. Mol. Cell. Biol. 20, 5700-5711.
Gorbsky, G. J. (1997). Cell cycle checkpoints: arresting progress in mitosis. Bioessays 19, 193-197.[Medline]
Gossen, M. and Bujard, H. (1992). Tight control of gene expression in mammalian cells by tetracycline responsive promoters. Proc. Natl. Acad. Sci. USA 89, 5547-5551.[Abstract]
Guacci, V., Koshland, D. and Strunnikov, A. (1997). A direct link between sister chromatid cohesion and chromosome condensation revealed through the analysis of MCD1 in S. cerevisiae. Cell 91, 47-57.[Medline]
He, D. and Brinkley, B. R. (1996). Structure and dynamic organization of centromeres-prekinetochores in the nucleus of mammalian cells. J. Cell Sci. 109, 2693-2704.
Hendzel, M. J., Yi, W., Mancini, M. A., Van Hooser, A., Ranalli, A., Brinkley, B. R., Bazett-Jones, D. P. and Allis, C. D. (1997). Mitosis-specific phosphorylation of histone H3 initiates primarily within pericentromeric heterochromatin during G2 and spreads in an ordered fashion coincident with mitotic chromosome condensation. Chromosoma 106, 348-360.[Medline]
Henikoff, S., Ahmad, K., Suso Platero, J. and van Steensel, B. (2000). Heterochromatic deposition of centromeric histone H3-like proteins. Proc. Natl. Acad. Sci. USA 97, 716-721.
Howman, E. V., Fowler, K. J., Newson, A. J., Redward, S., MacDonald, A. C., Kalitsis, P., Choo, K. H. (2000). Early disruption of centromeric chromatin organization in centromere protein A (Cenpa) null mice. Proc. Natl. Acad. Sci. USA 97, 1148-1153.
Kalitsis, P., Fowler, K. J., Earle, E., Hill, J. and Choo, K. H. A. (1998). Targeted disruption of mouse centromere protein C gene leads to mitotic disarray and early embryo death. Proc. Natl. Acad. Sci. USA 95, 1136-1141.
Karpen, G. H. and Allshire, R. C. (1997). The case for epigenetic effects on centromere identity and function. Trends Genet. 13, 489-496.[Medline]
Keith, K. C., Baker, R. E., Chen, Y., Harris, K., Stoler, S. and Fitzgerald-Hayes, M. (1999). Analysis of primary structural determinants that distinguish the centromere-specific function of histone variant Cse4p from histone H3. Mol. Cell. Biol. 19, 6130-6139.
Laemmli, U. K. (1970). Cleavage of structural proteins during the assembly of the head of bacteriophage T4. Nature 227, 680-685.[Medline]
Lanini, L. and McKeon, F. (1995). Domains required for CENP-C assembly at the kinetochore. Mol. Biol. Cell 6, 1049-1059.[Abstract]
Liao, H., Winkfein, R. J., Mack, G., Rattner, J. B. and Yen, T. J. (1995). CENP-F is a protein of the nuclear matrix that assembles onto kinetochores at late G2 and is rapidly degraded after mitosis. J. Cell Biol. 130, 507-518.[Abstract]
Masumoto, H., Masukata, H., Muro, Y., Nozaki, N. and Okazaki, T. (1989). A human centromere antigen (CENP-B) interacts with a short specific sequence in alphoid DNA, a human centromeric satellite. J. Cell Biol. 109, 1963-1973.[Abstract]
Meluh, P. B. and Koshland, D. (1995). Evidence that the MIF2 gene of Saccharomyces cerevisiae encodes a centromere protein with homology to the mammalian centromere protein CENP-C. Mol. Biol. Cell 6, 793-807.[Abstract]
Meluh, P. B. and Koshland, D. (1997). Budding yeast centromere composition and assembly as revealed by in vivo cross-linking. Genes Dev. 11, 3401-3412.
Meluh, P. B., Yang, P., Glowczewski, L., Koshland, D. and Smith, M. M. (1998). Cse4p is a component of the core centromere of Saccharomyces cerevisiae. Cell 94, 607-613.[Medline]
Merry, D. E., Pathak, S., Hsu, T. C. and Brinkley, B. R. (1985). Anti-kinetochore antibodies: use as probes for inactive centromeres. Am. J. Hum. Genet. 37, 425-430.[Medline]
Michaelis, C., Ciosk, R. and Nasmyth, K. (1997). Cohesins: chromosomal proteins that prevent premature separation of sister chromatids. Cell 91, 35-45.[Medline]
Mole-Bajer, J., Bajer, A. S., Zinkowski, R. P., Balczon, R. D. and Brinkley, B. R. (1990). Autoantibodies from a patient with scleroderma CREST recognized kinetochores of the higher plant Haemanthus. Proc. Natl. Acad. Sci. USA 87, 3599-3603.[Abstract]
Moroi, Y., Peebles, C., Fritzler, M., Steigerwald, J. and Tan, E. (1980). Autoantibody to centromere (kinetochore) in Scleroderma sera. Proc. Natl. Acad. Sci. USA 77, 1627-1631.[Abstract]
Nickerson, J. A., Krockmalnic, G., Wan, K. M. and Penman, S. (1997). The nuclear matrix revealed by eluting chromatin from a cross-linked nucleus. Proc. Natl. Acad. Sci. USA 94, 4446-4450.
Nicklas, R. B. (1997). How cells get the right chromosomes. Science 275, 632-637.
Niman, H. L., Houghten, R. A., Walker, L. E., Reisfeld, R. A., Wilson, I. A., Hogle, J. M. and Lerner, R. A. (1983). Generation of protein-reactive antibodies by short peptides is an event of high frequency: implications for the structural basis of immune recognition. Proc. Natl. Acad. Sci. USA 80, 4949-4953.[Abstract]
Odgren, P. R., Harvie, L. W., Jr and Fey, E. G. (1996). Phylogenetic occurrence of coiled coil proteins: implications for tissue structure in metazoa via a coiled coil tissue matrix. Proteins 24, 467-484.[Medline]
Ortiz, J., Stemmann, O., Rank, S. and Lechner, J. (1999). A putative protein complex consisting of Ctf19, Mcm21, and Okp1 represents a missing link in the budding yeast kinetochore. Genes Dev. 13, 1140-1155.
Ouspenski, I. I. and Brinkley, B. R. (1993). Centromeric DNA cloned from functional kinetochore fragments in mitotic cells with unreplicated genomes. J. Cell Sci. 105, 359-367.
Palmer, D. K., ODay, K., Trong, H. L., Charbonneau, H. and Margolis, R. L. (1991). Purification of the centromere-specific protein CENP-A and demonstration that it is a distinctive histone. Proc. Natl. Acad. Sci. USA 88, 3734-3738.[Abstract]
Rattner, J. B., Rao, A., Fritzler, M. J., Valencia, D. W. and Yen, T. J. (1993). CENP-F is a ca. 400 kDa kinetochore protein that exhibits a cell-cycle dependent localization. Cell Motil. Cytoskeleton 26, 214-226.[Medline]
Saffery, R., Irvine, D. V., Griffiths, B., Kalitsis, P., Wordeman, L. and Choo, K. H. (2000). Human centromeres and neocentromeres show identical distribution patterns of >20 functionally important kinetochore-associated proteins. Hum. Mol. Genet. 9, 175-185.
Saitoh, H., Tomkiel, J., Cooke, C. A., Ratrie, H., Maurer, M., Rothfield, N. F. and Earnshaw, W. C. (1992). CENP-C, an autoantigen in scleroderma, is a component of the human inner kinetochore plate. Cell 70, 115-125.[Medline]
Schmiesing, J. A., Ball, A. R., Gregson, H. C., Alderton, J., Zhou, S. and Yokomori, K. (1998). Identification of two distinct human SMC protein complexes involved in mitotic chromosome dynamics. Proc. Natl. Acad. Sci. USA 95, 12906-12911.
Shelby, R. D., Vafa, O. and Sullivan, K. F. (1997). Assembly of CENP-A into centromeric chromatin requires a cooperative array of nucleosomal DNA contact sites. J. Cell Biol. 10, 501-513.
Smith, M. M., Yang, P., Santisteban, M. S., Boone, P. W., Goldstein, A. T. and Megee, P. C. (1996). A novel histone H4 mutant defective for nuclear division and mitotic chromosome transmission. Mol. Cell. Biol. 16, 1017-1026.[Abstract]
Starr, D. A., Saffery, R., Li, Z., Simpson, A. E., Choo, K. H. A., Yen, T. J. and Goldberg, M. L. (2000). HZwint-1, a novel human kinetochore component that interacts with HZW10. J. Cell Sci. 113, 1939-1950.
Starr, D. A., Williams, B. C., Li, Z., Etemad-Moghadam, B., Dawe, R. K. and Goldberg, M. L. (1997). Conservation of the centromere/kinetochore protein ZW10. J. Cell Biol. 138, 1289-1301.
Starr, D. A., Williams, B. C., Hays, T. S. and Goldberg, M. L. (1998). ZW10 helps recruit dynactin and dynein to the kinetochore. J. Cell Biol. 142, 763-774.
Stoler, S., Keith, K. C., Curnick, K. E., and Fitzgerald-Hayes, M. (1995). A mutation in CSE4, an essential gene encoding a novel chromatin-associated protein in yeast, causes chromosome nondisjunction and cell cycle arrest at mitosis. Genes Dev. 9, 573-586.[Abstract]
Sullivan, K. F. (1998). A moveable feast: the centromere/kinetochore complex in cell division. In Mechanisms of Cell Division: Frontiers in Molecular Biology (ed. S. Endow and D. Glover). Oxford, UK: Oxford University Press.
Sullivan, B. A. and Schwartz, S. (1995). Identification of centromeric antigens in dicentric Robertsonian translocations: CENP-C and CENP-E are necessary components of functional centromeres. Hum. Mol. Genet. 12, 2189-2197.
Sullivan, K. F., Hechenberger, M. and Masri, K. (1994). Human CENP-A contains a histone H3 related histone fold domain that is required for targeting to the centromere. J. Cell Biol. 127, 581-592.[Abstract]
Takahashi, K., Chen, E. S. and Yanagida, M. (2000). Requirement of Mis6 centromere connector for localizing a CENP-A-like protein in fission yeast. Science 288, 2215-2219.
Tanaka, T., Pia Cosma, M., Wirth, K. and Nasmyth, K. (1999). Identification of cohesin association sites at centromeres and along chromosome arms. Cell 98, 847-858.[Medline]
Tomkiel, J., Cooke, C. A., Saitoh, H., Bernat, R. L. and Earnshaw, W. C. (1994). CENP-C is required for maintaining proper kinetochore size and for a timely transition to anaphase. J. Cell Biol. 125, 531-545.[Abstract]
Tyler-Smith, C. and Willard, H. F. (1993). Mammalian chromosome structure. Curr. Opin. Genet. Dev. 3, 390-397.[Medline]
Tyler-Smith, C., Gimelli, G., Giglio, S., Floridia, G., Pandya, A., Terzoli, G., Warburton, P. E., Earnshaw, W. C. and Zuffardi, O. (1999). Transmission of a fully functional human neocentromere through three generations. Am. J. Hum. Genet. 64, 1440-1444.[Medline]
Valdivia, M. M. and Brinkley, B. R. (1985). Fractionation and initial characterization of the kinetochore from mammalian metaphase chromosomes. J. Cell Biol. 101, 1124-1134.[Abstract]
Van Hooser, A. and Brinkley, B. R. (1999). Methods for in situ localization of proteins and DNA in the centromere-kinetochore complex. Methods Cell Biol. 61, 57-80.[Medline]
Van Hooser, A. A., Mancini, M. A., Allis, C. D., Sullivan, K. F. and Brinkley, B. R. (1999). The mammalian centromere: structural domains and the attenuation of chromatin modeling. FASEB J. 13, S216-S220.[Medline]
Vig, B. K. and Rattner, J. B. (1989). Centromeres, kinetochores and cancer. CRC Crit. Rev. Oncogenes 1, 343-371.
Warburton, P. E., Cooke, C. A., Bourassa, S., Vafa, O., Sullivan, B. A., Stetten, G., Gimelli, G., Warburton, D., Tyler-Smith, C., Sullivan, K. F., Poirier, G. G. and Earnshaw, W. C. (1997). Immunolocalization of CENP-A suggests a distinct nucleosome structure at the inner kinetochore plate of active centromeres. Curr. Biol. 7, 901-904.[Medline]
Wiens, G. R. and Sorger, P. K. (1998). Centromeric chromatin and epigenetic effects in kinetochore assembly. Cell 93, 313-316.[Medline]
Williams, B. C., Karr, T. L., Montgomery, J. M. and Goldberg, M. L. (1992). The Drosophila l(1)zw10 gene product, required for accurate mitotic chromosome segregation, is redistributed at anaphase onset. J. Cell Biol. 118, 759-773.[Abstract]
Wolffe, A. P. and Pruss, D. (1996). Deviant nucleosomes: the functional specialization of chromatin. Trends Genet. 12, 58-62.[Medline]
Yang, C. H., Tomkiel, J., Saitoh, H., Johnson, D. H. and Earnshaw, W. C. (1996). Identification of overlapping DNA-binding and centromere-targeting domains in the human kinetochore protein CENP-C. Mol. Cell Biol. 16, 3576-3586.[Abstract]
Yen, T. J., Compton, D. A., Wise, D., Zinkowski, R. P., Brinkley, B. R., Earnshaw, W. C. and Cleveland, D. W. (1991). CENP-E, a novel human centromere-associated protein required for progression from metaphase to anaphase. EMBO J. 10, 1245-1254.[Abstract]
Yen, T. J., Li, G., Schaar, B. T., Szilak, I. and Cleveland, D. (1992). CENP-E is a putative kinetochore motor that accumulates just before mitosis. Nature 359, 536-539.[Medline]
Yoda, K. ando, S., Morishita, S., Houmura, K., Hashimoto, K., Takeyasu, K. and Okazaki, T. (2000). Human centromere protein A (CENP-A) can replace histone H3 in nucleosome reconsitution in vitro. Proc. Natl. Acad. Sci. USA 97, 7266-7271.
Zinkowski, R. P., Meyne, J. and Brinkley, B. R. (1991). The centromere-kinetochore complex: a repeat subunit model. J. Cell Biol. 113, 1091-1110.[Abstract]