Institute of Biological Chemistry, Washington State University, Pullman, Washington 99164-6340
![]() |
Abstract |
---|
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
---|
Plant cells may contain two functionally distinct vacuolar compartments. Membranes of protein
storage vacuoles (PSV) are marked by the presence of
-tonoplast intrinsic protein (TIP), whereas lytic vacuoles (LV) are marked by the presence of
-TIP. Mechanisms for sorting integral membrane proteins to the different vacuoles have not been elucidated. Here we
study a chimeric integral membrane reporter protein
expressed in tobacco suspension culture protoplasts whose traffic was assessed biochemically by following
acquisition of complex Asn-linked glycan modifications
and proteolytic processing, and whose intracellular localization was determined with confocal immunofluorescence. We show that the transmembrane domain of
the plant vacuolar sorting receptor BP-80 directs the reporter protein via the Golgi to the LV prevacuolar
compartment, and attaching the cytoplasmic tail (CT)
of
-TIP did not alter this traffic. In contrast, the
-TIP
CT prevented traffic of the reporter protein through
the Golgi and caused it to be localized in organelles separate from ER and from Golgi and LV prevacuolar
compartment markers. These organelles had a buoyant
density consistent with vacuoles, and
-TIP protein
colocalized in them with the
-TIP CT reporter
protein when the two were expressed together in protoplasts. These results are consistent with two separate
pathways to vacuoles for membrane proteins: a direct
ER to PSV pathway, and a separate pathway via the
Golgi to the LV.
![]() |
Introduction |
---|
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
---|
TRAFFIC of proteins within the secretory pathway of
plant cells is complex because plant cells may store
proteins within a vacuolar compartment. The stored
proteins must be kept separate from active proteases that
would degrade them. Presumably for that reason, in contrast to yeast, plant cells may contain two functionally distinct types of vacuoles: protein storage vacuoles (PSVs)1
and lytic vacuoles (LVs) (Okita and Rogers, 1996). In barley root tip cells, PSVs contain barley lectin and are
marked by the presence of
-TIP (tonoplast intrinsic protein) in the tonoplast, whereas LVs contain the cysteine
protease aleurain and are marked by
-TIP (Paris et al.,
1996
) (Jauh, G.-Y., and J.C. Rogers, unpublished data).
A separate vesicular pathway leads to each type of vacuole; soluble proteins are carried to the LV compartment in
clathrin-coated vesicles (CCV), whereas storage proteins
are carried to the PSV in smooth, dense vesicles (Hinz
et al., 1995; Hohl et al., 1996
; Okita and Rogers, 1996
). We
have purified, cloned, and characterized a protein identified as BP-80 that appears to serve as a vacuolar sorting receptor (VSR) for proteins sorted to the LV (Kirsch et al.,
1994
; Paris et al., 1997
). BP-80 is a 623-amino acid Type I
transmembrane protein with a 37-amino acid cytoplasmic
tail (CT) that binds the proaleurain targeting determinant
with high affinity at neutral pH, and releases the ligand at
pH <5. The protein was localized to the dilated ends of
Golgi cisternae and to "prevacuoles," structures ~250 nm
in size that were adjacent to and appeared to be able to
fuse with large LVs (Paris et al., 1997
). BP-80 was enriched
in CCV preparations from developing peas (Kirsch et al.,
1994
). Recently Hohl et al. (1996)
prepared highly purified
pea CCV that lacked immunologically detectable vicilin
and legumin storage proteins but contained abundant BP-80. In contrast, preparations of smooth dense vesicles that
contain abundant vicilin and legumin and are thought to
carry storage proteins from Golgi to PSV have little BP-80
(Robinson et al., 1998
). Thus, BP-80 appears to be a specific marker for the CCV to LV pathway.
In contrast to emerging knowledge about sorting of soluble proteins to plant vacuoles, relatively little is known
about the biogenesis of separate vacuolar compartments,
although some evidence indicates that the PSV may develop directly from the ER (Robinson et al., 1995). We are
interested in understanding mechanisms by which integral
membrane proteins are directed specifically to one vacuole and not the other. Such sorting is emphasized by the abundance of
-TIP in PSV and
-TIP in LV tonoplast,
and it has been suggested that the TIP isoform may be a
primary determinant of vacuole function (Neuhaus and
Rogers, 1998
).
Here we use BP-80 as a marker for the LV pathway.
Our first goal was to understand the role of the transmembrane domain (TMD) and CT in traffic of BP-80 within
the cell. In yeast systems, chimeric proteins that are altered as they pass through different compartments have
been used efficiently to study determinants important in
their trafficking (Nothwehr et al., 1993, 1995
; Nothwehr and Stevens, 1994
). We used a similar approach to design a
reporter construct for plant cells. The NH2-terminal portion of our construct contains a mutated form of the cysteine protease proaleurain that lacks efficient vacuolar targeting determinants and is secreted when expressed in
tobacco suspension culture protoplasts (construct 8; Holwerda et al., 1992
). In its soluble form, 42-kD wild-type proaleurain is proteolytically processed into 32-kD mature
aleurain in an acidified post-Golgi compartment and accumulates in LV (Holwerda et al., 1990
, 1992
). The structure
of proaleurain is highly conserved in different plant species (Rogers et al., 1997
), and processing of the enzyme expressed in tobacco suspension culture cells (Holwerda et al.,
1992
) was indistinguishable from processing in barley aleurone cells (Holwerda et al., 1990
). In our reporter construct, the mutated proaleurain is attached through linker
sequences to the short Ser/Thr-rich domain of BP-80 that,
in turn, is attached to the TMD and CT of BP-80. Thus,
when expressed in tobacco suspension culture protoplasts
and followed by pulse-chase labeling with [35S]methionine + cysteine and immunoprecipitation, proteolytic processing of proaleurain in the construct would only occur if
the chimeric transmembrane protein reached the proper
compartment, the lytic prevacuole (see Discussion).
Here we show that proaleurain in the construct remained membrane associated until it was directed to the
lytic prevacuolar compartment where proaleurain processing occurred. The reporter protein passed through the
Golgi before reaching the lytic prevacuolar compartment
because it acquired Golgi-specific modifications to plant
complex Asn-linked glycans (Lauriér et al., 1989), and brefeldin A (BFA) prevented the processing of its proaleurain moiety. Deletion studies on the CT of the reporter construct indicated that the BP-80 TMD alone was
sufficient for lytic prevacuolar targeting in tobacco cells.
We therefore tested the effects of substituting either the
17-amino acid CT of
-TIP onto the BP-80 TMD, or the
TMD of
-TIP with or without the BP-80 CT. In all instances, substitution of one of the
-TIP domains prevented acquisition of plant complex Asn-linked glycans
and abolished targeting of the reporter protein to the lytic
prevacuolar compartment. In contrast, substitution of the
BP-80 CT sequences with a 12-amino acid
-TIP COOH-terminal CT still resulted in prevacuolar targeting of the
reporter proteins. These results show that changes in the reporter CT do not cause misfolding and retention of
the reporter protein in the ER. The specificity of these results was confirmed by comparing the localization of the
different reporters to tobacco VSR proteins, markers for
Golgi and lytic prevacuole, and to calnexin and BiP as ER
markers using confocal immunofluorescence. Whereas the
BP-80 TMD/CT reporter colocalized with VSR proteins,
the reporter carrying the
-TIP CT substitution was in a compartment separate from both VSR proteins and calnexin
or BiP. Thus, the
-TIP CT substitution directed the reporter from the ER into a different pathway than that followed by the reporter carrying the BP-80 TMD/CT.
Subcellular fractionation and immunofluorescence studies demonstrated that the reporter containing the
-TIP CT
substitution was in the same vacuolar fraction and colocalized with the full-length
-TIP protein when these two
were coexpressed in tobacco protoplasts. Thus the
-TIP
CT reporter protein was targeted to the same compartment as that marked by the
-TIP protein. These results
define the relative importance of the BP-80 TMD and CT
sequences in traffic of that protein, and demonstrate the
presence of an alternative sorting mechanism within the
plant cell ER that recognizes the
-TIP CT and directs it
to a separate organelle compartment in tobacco cells.
![]() |
Materials and Methods |
---|
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
---|
Materials
Enzymes used in DNA manipulation were purchased from New England BioLabs (Beverly, MA). Protein A and protein G agarose were from Sigma Chemical Co. (St. Louis, MO). [35S]methionine + cysteine cell labeling mixture was obtained from Amersham Co. (Arlington Heights, IL). All oligonucleotides were synthesized by Integrated DNA Technologies (Coralville, IA).
Oligonucleotides
The sequences of oligonucleotides used in this study as polymerase chain reaction (PCR) primers are listed as follows: Li1, GAATTCGACTACAAGGACGACGATGACAAGAGTAAAACTGCCAGTCAG; Li2, GGGAGCTCAACCTCTTTGATGATT; Li3, GGAGACCAAAGACTGGAGGGA; Li4, GGGAGCTCAAAGGAATCCCCCTCC; Li5, GGGAGCTCACCTAATTCTATATTT; Li6, GGGAGCTCATCTGATTTCAGAATC; Li7, GGGAGCTCATTGGCTGTCCAAGGG; Li9, GGG- AGCTCAACCACTTTGATGATTGACGTGATTTGGACCTTCTTC-CTTAATTCTATATTT; Li10, GGAGCTCAGATATCATTGGCGTGCACGACCTGATGCTGGTTTGCTCCTACCCTAATTCTATATTT ; Li19, GGGGAGCTCAGTAATCTTCAGTTGCCAAAGGTTGGTG-GTGGTGTGGGGGTGGTTCAATTGGCCTAATTCTATATTTAT-ACAC; Li20, GGGAATTCGACTACAAGGACGACGATGACAGT-GGATCTTCTGGGTGGGTCCA; Li21, GGGGGGAGCTCAGTAAT-CTTCAGTTGCCAAAGG; Li22, GGGGAATTCTCTAGGCCTCTT-ACCCCGTTTGCCTATTCTAGGCCTCTTACCCCGTTTGCCTATT-GCTTCTCGTTTGTACATTCC; Li28, GGGGGGAGCTCAGATCACAGCATATTCATACAC; Li29, GGGGAATTCGACTACAAGGACGACGATGACAAGTGGATCTTCTGGGTGGGTCCACTACTTGG-GCTGCACTGGCAGCACTGGTGTATGAATATGCTGTGATCGT-GTATAAATATAGAATTAGG; Li46, GGGGGGAGCTCAATAGT-CGGTTGTTGGAAGTTGTTCGTGTGTTCTGCTCCTAATTCTAT-ATTTATACACAAG; Li84, GGGGGATCCATGGCAACCCGAAG-ATATTCTTTT.
Plasmid Construction
Methods for plasmid construction have been described previously (Holwerda et al., 1992). The cloning of BP-80 has been described (Paris et al.,
1997
). All DNA constructs were derived by combining a mutated form of
the proaleurain cDNA (Rogers et al., 1985
) as a reporter and the Ser/Thr-rich region (defined as spacer), TMD, and CT of the BP-80 cDNA. The
proaleurain cDNA used here was a mutated form which lacks efficient
vacuolar targeting determinants and is secreted when expressed in tobacco suspension culture cells (construct 8; Holwerda, et al., 1992). Between proaleurain and BP-80 sequences (spacer-TMD-CT) were inserted
linker sequences comprised of two Gly residues followed by a single Kex2
cleavage site (MYKREA) (Tao et al., 1990
) and a FLAG epitope-tag sequence (DYKDDDDK; Eastman-Kodak, Rochester, NY), which would
allow use of a monoclonal antibody (FLAG M2) against FLAG sequences
to detect the reporter protein. To facilitate cloning of constructs with altered TMD/CT domains, an EcoRI site (encoding amino acids EF) was
placed between the Kex2 cleavage site and the FLAG sequences; a
BamHI site was present in front of the mutated proaleurain cDNA and a
SacI site was engineered immediately after the translational stop codon.
All these result in the following chimeric fusion protein: BamHI-mutated
proaleurain-Kex2 cleavage site-EcoRI-FLAG-Spacer-TMD-CT of BP-80-Stop-SacI. The amino acid sequence of the basic construct, shown as beginning with the four COOH-terminal proaleurain amino acids (VVAA)
is as follows:
This BamHI-SacI fragment was then used to replace the -glucuronidase (GUS) sequences in plasmid pBI221 (Jefferson et al., 1987
),
which allowed expression in tobacco suspension culture protoplasts under
the control of the cauliflower mosaic virus 35S promoter and resulted in
construct 491.
Oligonucleotides Li1 and 2 were used to make construct 491; Li 4 to Li7 were used to create constructs 500-503; Li9 and Li10 were used for making 512 and 513 constructs; Li19, Li20 and Li21 were used to make constructs 526 and 527; Li3 and Li22 were used to make 530 and 531 constructs; Li28 and Li29 were used to make constructs 539 and 540, respectively. Most of the constructs were derived from others by using 491 as a templates for PCR, e.g., constructs 500-503 required 491 as template; 531 required 501 as template. PCR reactions were run for 30-35 cycles using the following program: denaturation at 94°C for 1 min, annealing for 1.5 min at 42°-55°C, and polymerization at 72°C for 1 min. The annealing temperatures were selected based on the predicted melting temperature of the primers. The fidelity of all modifications to the original construct, 491, were confirmed by DNA sequencing.
To express the full-length bean -TIP protein (construct 633), the coding sequence of
-TIP was amplified via PCR using the
-TIP cDNA
(Johnson et al., 1990) as template and cloned into the expression cassette
plasmid pBI221 via BamHI and SacI sites, which allows the expression of
the
-TIP protein in tobacco protoplasts under the control of 35S promoter.
Antibodies
Affinity-purified polyclonal rabbit antibodies highly specific for aleurain
used in this study have been described (Holwerda et al., 1992) and the
monoclonal antibody against FLAG (M2) was purchased from Eastman-Kodak. Affinity-purified polyclonal rabbit antibodies (RA3) against a
synthetic peptide representing the NH2-terminal 15-amino acid of BP-80
and a monoclonal mouse antibody (14G7) against BP-80 have been characterized (Paris et al., 1997
). A second monoclonal antibody to BP-80,
17F9, was prepared in a similar manner (Cao, X.-F., and J.C. Rogers, unpublished data). Affinity-purified polyclonal rabbit antibodies raised
against synthetic
-TIP CT peptide (CHQPLATEDY) have been
described (Jauh et al., 1998
) and the rabbit antisera raised against bean
-TIP protein (Johnson et al., 1990) was gift from M.J. Chrispeels (University of California, San Diego, CA). Antiserum for plant complex Asn-linked glycans (Lauriér et al., 1989
) was generously provided by A. Sturm
(Friedrich Miescher Institute, Basel, Switzerland). Anti-castor bean calnexin antiserum and anti-tomato BiP/grp78 antisera were generously provided by S. Coughlan (Pioneer HiBred, Johnson, IA) and D. Meyer and
A. Bennett (University of California, Davis, CA), respectively. Secondary
Cy5- or lissamine rhodamine-conjugated affinity-purified anti-rabbit or
-mouse antibodies were purchased from Jackson ImmunoResearch Laboratories (West Grove, PA).
Transient Expression, Cell Labeling, Subcellular Fractionation, Vacuole Isolation, and Immunoprecipitation
Tobacco protoplast preparation and transfection, cell labeling protocols,
and detection of labeled proteins in different fractions by immunoprecipitation and fluorography were carried out essentially according to Holwerda et al. (1992) with some modifications. About 2 × 106 protoplasts in
1 ml of electroporation buffer were electroporated with 60 µg of plasmid
DNA. After dilution into 10 ml of Murashige and Skoog (Murashige and
Skoog, 1962
) medium with 3% mannitol, the cells were allowed to recover
overnight in the dark at room temperature before labeling. At the end of
labeling/pulse or chase, the culture medium was gently separated from
the cells by aspirating with a micropipette tip plugged with glasswool, and
the resulting medium (M) fraction was kept on ice after adding 1/4 vol of
250 mM Tris-HCl, pH 7.4, 750 mM NaCl, 5 mM EDTA, 0.5 mM phenylmethylsulfonyl fluoride (PMSF), and 25 µg/ml leupeptin. Cells were then
suspended in buffer containing 50 mM Tris-HCl, pH 7.4, 125 mM NaCl,
1 mM EDTA, 0.1 mM PMSF, 5 µg/ml leupeptin, and then sonicated on ice to allow separation of membranes from soluble proteins. After centrifugation at 10,000 g for 15 min, the supernatant was separated from the pellet
and designated the cell soluble fraction (CS); the membrane pellet was
then resuspended in buffer containing 50 mM Tris-HCl, pH 7.4, 125 mM
NaCl, 1 mM EDTA, 0.1 mM PMSF, 5 µg/ml leupeptin, and then designated the cell membrane fraction (CM).
To rule out the possibility of protease activity which could result in nonspecific cleavage of proaleurain in newly formed vesicles during cell sonication, a control experiment was done in which the cells were sonicated in the presence of 1% SDS, followed immediately by immunoprecipitation.
Vacuoles were also prepared from continuously labeled or pulse-
chase-labeled protoplasts using a Ficoll step gradient as described (Guy
et al., 1979; Holwerda et al., 1992
). In brief, [35S]Met + Cys-labeled protoplasts were washed and resuspended in electroporation buffer and layered
on a step gradient of 12 and 15% Ficoll (Mr 400,000; Sigma Chemical Co.)
in 0.6 M mannitol and 20 mM Hepes, pH 7.7. After centrifugation at
42,000 rpm (170,000 g) for 2 h at 4°C in an SW 50.1 rotor (Beckman Instrs., Palo Alto, CA), the vacuole (V) fraction was removed and adjusted
to a final concentration of 50 mM Tris-HCl, pH 7.4, 125 mM NaCl, 1 mM
EDTA, 0.1 mM PMSF, 5 µg/ml leupeptin. The dense pellet (P) was resuspended in 0.25 ml of the same buffer.
SDS was then added to each fraction (M, CS, CM, V, and P) to a final
concentration of 1% and samples were heated at 100°C for 10 min. After
dilution with 4 vol of 50 mM Tris-HCl, pH 7.4, 125 mM NaCl, 0.25% Nonidet P-40 (Sigma Chemical Co.), samples were incubated with 4 µg of affinity-purified anti-aleurain antibody at 4°C overnight. 100 µl of protein
A-agarose (Sigma Chemical Co.) was then added and incubated for 4 h at
4°C with continuous agitation. Immunoprecipitation with either FLAG
monoclonal antibody or antiserum to plant complex Asn-linked glycans
was performed after previous selection of the proteins with anti-aleurain
antibody. The anti-aleurain immunoprecipitated proteins were released
from protein A-agarose by heating at 100°C in buffer containing 50 mM
Tris-HCl, pH 7.4, 125 mM NaCl, 1 mM EDTA, 0.1 mM PMSF, 5 µg/ml leupeptin, and 1% SDS for 5 min, and the released proteins were then immunoprecipitated with FLAG monoclonal antibody (4 µg) or antiserum
to plant complex Asn-linked glycans (15 µl) after dilution as described
above. The immune complexes were then selected with either protein
G-agarose or protein A-agarose (Sigma Chemical Co.), respectively. Immunoprecipitated proteins were then analyzed by SDS-PAGE and radiography as previously described (Holwerda et al., 1992). After electrophoresis, gels were treated with En3Hance (Dupont, Boston, MA), dried, and
then exposed to film (BIOMAX; Eastman-Kodak) at
80°C for 3-6 wk.
Confocal Immunofluorescence Studies
After incubation at room temperature for 16-20 h, tobacco protoplasts expressing various constructs were fixed in buffer containing 3% mannitol
and permeabilized as described (Paris et al., 1996). For immune double labeling, polyclonal rabbit and mouse monoclonal antibodies were incubated together with the fixed protoplasts at 4°C overnight at the following
working concentrations: 2 µg/ml for anti-aleurain, 10 µg/ml for anti-FLAG M2 (Eastman-Kodak) and 14G7 or 17F9 anti-VSR monoclonals,
1:100 dilution for both anti-calnexin and anti-BiP antisera. At these antibody concentrations, neither aleurain nor FLAG detected any signals
from cells expressing the control plasmid pBI221 (see Results). The
primary antibodies were detected with Cy5-conjugated or lissamine
rhodamine-conjugated anti-mouse or anti-rabbit secondary antibodies as
described (Paris et al., 1996
). All confocal fluorescence images were collected using a Bio-Rad MRC 1024 system (Hercules, CA) with the following parameters: 60× objective, 1× zoom, 1,250 gain, 2.2 iris, 0 background, and 0.348 pixel size. A Cy5/rhodamine software program was
used to collect images under conditions where no crossover between rhodamine and Cy5 emissions occurs and the two images are collected sequentially from the same optical section. The Cy5 images are pseudocolored in green and the rhodamine images are pseudocolored in red. All images from cells expressing reporter proteins were collected with a laser
level of <3% to ensure that the signal was within the linear range of detection (typically 0.3 or 1% laser was used). For cells electroporated with
the control pBI221 plasmid, 30 or 100% laser intensity was used to collect
images to demonstrate that no endogenous background staining for aleurain or FLAG antibodies could be detected. Images were processed using Adobe Photoshop software (San Jose, CA) as described (Paris et al.,
1996
).
Quantitation of Colocalization by Different Antibodies
Superimposition of red and green images results in yellow where the red
and green overlap. The total area of the image occupied by yellow in the
superimposed mode, divided by the total area of the image occupied by
red in the red mode only is therefore a fraction describing how much of
the red signal colocalizes with green. Individual files for red/green (superimposed) and red only images were opened with Adobe Photoshop, and
pixels occupied by one color were highlighted using the Select and Similar
functions. Highlighted areas were then stored as black on white files. The total area (in mm2) occupied by black was then quantitated using NIH Image 1.61 (available at http://rsb.info.nih.gov/nih-image/). Images from at
least 10 different cells from each double-label experiment were analyzed
in this manner to calculate antibody colocalization. A similar approach
has been used to quantitate the colocalization of two proteins in the yeast
cells (Jungmann and Munro, 1998). Results from different experiments
were compared with a two-tailed Student's t test after transformation of
the fractions obtained to log normal distribution.
![]() |
Results |
---|
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
---|
Traffic of the Reporter Protein to a Site Where the Proaleurain Moiety Is Processed to Mature Aleurain
We constructed a series of reporter proteins where the mutated proaleurain, lacking vacuolar targeting determinants, was connected to the TMD and CT of BP-80 via a potential Kex2 cleavage site and FLAG epitope tag sequences (as linker): VVAAGGMYKREAEFDYKDDDDKSKTASQAK, where VVAA is the COOH terminus of proaleurain, GG residues are engineered spacers to permit flexibility, and EF is the introduced EcoRI site; the Kex2 cleavage site and FLAG epitope tag sequences are single and double underlined, respectively. The Kex2 cleavage site was included initially to look for cleavage of 42-kD proaleurain from membrane association as a marker for transit through the Golgi. No such cleavage was observed. Construct 491, which contains the mutated proaleurain, the linker, and the TMD and CT of BP-80, was the starting construct. The amino acid sequences of COOH-terminal regions for constructs in Fig. 1 are shown in Table I.
|
|
The predicted results from expressing these chimeric
constructs in tobacco protoplasts are as follows: (a) The
full-length reporter proteins would be integral membrane
proteins. (b) Traffic of the reporter proteins through the
Golgi would result in modification of at least one of the
proaleurain Asn-linked oligosaccharides to complex form
(Holwerda et al., 1990), detectable with anti-complex plant Asn-linked glycan antibodies (Lauriér et al., 1989
).
(Additional modifications recognized by the antibodies
might occur if O-linked glycosylation occurred in the Ser/
Thr-rich BP-80 spacer sequence.) (c) If the reporter protein was directed to the lytic "prevacuole" (see Discussion), the proaleurain portion would be processed to mature aleurain with loss of 10 kD in size, but would remain
membrane-associated. (d) Cleavage within the linker sequences after reaching the lytic prevacuole would result in
release of 32-kD mature aleurain into soluble form. (e)
Cleavage within the linker sequences would result in separation of epitopes recognized by anti-aleurain polyclonal antibodies from those recognized by the FLAG monoclonal antibody.
Fig. 2 A shows results from an experiment where construct 491 reporter protein expression in tobacco protoplasts was assayed by immunoprecipitation with anti-aleurain antibodies after 1 h of pulse labeling and 2 h of chase. At the end of the 1-h labeling period, most proteins selected by anti-aleurain antibodies formed a heavily labeled dimer of ~47 and 50 kD in the CM fraction (Fig. 2 A, 10,000 g pellet; solid arrow, lane 2), whereas a much smaller amount remained in the CS fractions (Fig. 2 A, 10,000 g supernatant, lane 1). However, after a chase period of 2 h, two proteins (32 and 35 kD) were detected in the CS fractions (Fig. 2 A, single asterisk, lane 3); the abundance of these 32/35 kD proteins increased from 0 to 2 h of chase (Fig. 2 A, asterisk, compare lane 1 with 3), whereas the amount of full-length, membrane-associated 47/50 kD proteins reciprocally decreased (Fig. 2 A, solid arrow, compare lane 2 with 4), indicating that the 32- and 35-kD processed forms were derived directly from the full-length membrane-associated proteins. The lower 32-kD band from the CS fraction (Fig. 2 A, single asterisk, lane 3) was indistinguishable in size from that of mature aleurain, as indicated by comparing the lower 32-kD band from the CS fraction (Fig. 2 A, single asterisk, lane 6) to the mature aleurain (Fig. 2 A, single asterisk, lane 8) processed from the soluble proaleurain (Fig. 2 A, P, lane 8, single dot at right) expressed in tobacco cells. No soluble proaleurain and mature aleurain were detected in the medium fraction (Fig. 2 A, M, lane 5). The presence of double bands for both processed aleurain (32 and 35 kD) and the full-length reporter protein (47 and 50 kD) were most likely due to additional posttranslational modifications, such as O-linked glycosylation.
|
There was an unexpected feature to these results. After processing of proaleurain in the reporter protein, the resulting mature aleurain was expected to remain membrane associated (attached to the TMD and CT of BP-80). However, in all of these experiments, it became soluble and was detected exclusively in the CS fraction (Fig. 2 A, single asterisk, lanes 3 and 6), and neither soluble proaleurain nor mature aleurain was detected in the medium (M) fraction (Fig. 2 A, lane 5). Importantly, only mature aleurain was identified as a processing product and no evidence for release of soluble proaleurain was obtained in these experiments. Therefore, this release from membrane association appeared to occur essentially simultaneously with processing of proaleurain to mature aleurain, and the two steps were interpreted to occur in the same lytic prevacuolar compartment. To address this question, we compared protein immunoprecipitated with anti-aleurain and with anti-FLAG antibodies (Fig. 2 B). No secreted proaleurain or mature aleurain was observed in the medium (M) fraction (Fig. 2 B, lanes 1 and 4). The full-length reporter proteins were present in both CS and CM fractions selected with either antibody (Fig. 2 B, solid arrow, lanes 2, 3, 5, and 6). The mature aleurain doublet (Fig. 2 B, single asterisk, lane 2) was immunoprecipitated from the CS fraction using anti-aleurain antibodies; in contrast, no soluble aleurain was immunoprecipitated from the identical half sample using FLAG antibody (Fig. 2 B, lane 5). These results demonstrate that proteolytic processing of proaleurain was accompanied by cleavage of aleurain from membrane association at a site that separated the aleurain epitopes from the FLAG epitope. When another construct in which the FLAG sequence was deleted was expressed in tobacco protoplasts, little mature aleurain was detected in the CS fraction (data not shown). This result demonstrated that cleavage from membrane association was dependent upon the presence of the FLAG sequence. We therefore defined the presence of the 32/35-kD aleurain bands in the CS fraction as proof the reporter protein reached the proper lytic prevacuolar compartment. In most subsequent experiments, to facilitate analysis of multiple different constructs, we simply assessed the presence or absence of these bands as proof for correct targeting after continuously labeling cells with [35S]methionine + cysteine for 2 or 3 h. Therefore, in these experiments (Fig. 2 A, lanes 5-8, and B-D; Fig. 3 B; Figs. 4 and 5), the bands for the full-length reporter protein in the CM fraction appear more prominent than the bands for processed aleurain in the CS fraction. Mature aleurain has only 5 Cys and 4 Met residues whereas the full-length reporter protein carries 6 Cys and 10 Met residues; therefore, the autoradiographic signal from mature aleurain will be less intense than the signal from a similar amount of full-length reporter protein after labeling with [35S]methionine + cysteine.
|
|
|
|
A variable small amount of the full-length fusion protein, presumably membrane associated, was detected in the CS fraction (Fig. 2, A and B). We hypothesized that the full-length reporter protein detected in the CS fraction was present in vesicles that would not be pelleted during the 10,000 g centrifugation used to separate the CS and CM fractions. Therefore, a 10,000 g supernatant CS sample was divided into two parts. One half was further centrifuged at 100,000 g for 30 min and the resulting pellet (P) and supernatant (S) fractions were then compared with the uncentrifuged portion after immunoprecipitation with anti-aleurain antibodies. As shown in Fig. 2 C, most of the full-length reporter protein was detected in the 100,000 g pellet (P, solid arrow, lane 2), and, importantly, all mature aleurain was detected in the 100,000 g S fraction (single asterisk, lane 3). These data indicate that detection of full-length reporter protein in the CS fraction was indeed due to vesicle contamination.
To rule out the possibility that the process of sonication followed by centrifugation led to nonspecific processing of proaleurain despite the presence of protease inhibitors, a control experiment was done in which sonication of the protoplasts was carried out in the presence of 1% SDS, followed immediately by heating at 100°C for 10 min and then processing for immunoprecipitation using anti-aleurain antibodies. As shown in Fig. 2 D, both full-length reporter protein (solid arrow, lane 2) and mature aleurain doublet (single asterisk, lane 2) were detected from the SDS sonication sample (CS/CM, lane 2). The amount of aleurain recovered was similar to that recovered in the CS fraction from an equal volume of protoplasts processed in the standard manner (Fig. 2 D, CS, single asterisk, lane 1), confirming that nonspecific processing of proaleurain did not occur in our protocol. These results also demonstrate that the amount of anti-aleurain antibody used in the standard procedure was sufficient to detect other forms of proaleurain/aleurain in the CM fraction if they were present.
The Reporter Protein Traffics through the Golgi before Reaching the Site of Proaleurain Processing
The relative abundance of the 47/50-kD full-length reporter protein at time points after its synthesis would depend upon two separate processes: (a) the rate of proper
folding to allow exit from the ER, and (b), after exit from
the ER, transit to the site of proaleurain processing and
the efficiency of that process. We estimated the rates for
each of these two processes by reimmunoprecipitating half
of the original anti-aleurain immunoprecipitates from a
pulse-chase experiment with anti-plant complex Asn-linked glycan antibodies. The modification allowing recognition by these antibodies occurs in the Golgi; thus the
time necessary to generate molecules recognized by the
antibodies measures exit from the ER, and the acquisition of this modification documents Golgi transit. As shown in
Fig. 3 A, consistent with previous results (Fig. 1 A), the
abundance of the full-length reporter protein detected by
anti-aleurain antibodies decreased during chase from 0-2 h
(Fig. 3 A, lanes 1-3). However, little of the full-length reporter protein was immunoprecipitated by the anti-plant
complex Asn-linked glycan antibodies after 1 h pulse labeling (Fig. 3 A, arrow, lane 4), but the amount immunoprecipitated by these glycan antibodies greatly increased
during the first hour of chase (arrow, lane 5). This result
indicates that ~1 h is required for the reporter protein to
be synthesized, fold, and exit the ER. Once the reporter
protein reaches the Golgi, it rapidly transits to a site of
processing as demonstrated by a decrease in intensity of
the 47/50-kD molecules during the second hour of chase
(Fig. 3 A, arrows, compare lanes 5 and 6). The diminished
intensity of bands immunoprecipitated by anti-plant complex Asn-linked glycan antibodies relative to those immunoprecipitated by anti-aleurain antibodies is reasonable when it is considered that the former must identify a single xylose residue to select a labeled protein molecule
(Lauriér et al., 1989) whereas the latter identify epitopes
throughout the length of the mature aleurain propeptide
sequence.
To further determine if transit through the Golgi is necessary before processing of any of the reporter molecules
can occur, we tested the effect of BFA on traffic of the reporter protein. In studying expression of the integral membrane protein -TIP and the soluble protein phytohemagglutinin (PHA) in transgenic tobacco cells, Gomez and
Chrispeels (1993)
demonstrated that BFA prevented PHA
from reaching the vacuole but had no effect on sorting of
-TIP. The latter result suggested that
-TIP might move
directly from ER to vacuole. We therefore tested the effect of BFA on traffic of our reporter protein to the site of
proaleurain processing (Fig. 3 B). Consistent with previous results, mature aleurain was present in the CS fraction
following 2 h of chase after 1 h of labeling (Fig. 3 B,
BFA, asterisk, lane 1). In contrast, when 20 µg/ml BFA
was included in the culture medium during the labeling
and chase periods, little mature aleurain was detected in
the CS fraction (Fig. 3 B, +BFA, lane 3). Similar results
were obtained when BFA at a concentration of 10 µg/ml
was used (data not presented). The 29-kD band in the CS
fraction (Fig. 3 B, double asterisk, lane 3) and, in other figures in the CS fraction, is an endogenous tobacco protein
previously noted to be recognized by our antibodies (Holwerda et al., 1992
), and is present in extracts of control
cells not transfected with DNA (data not shown). Because BFA blocks forward ER to Golgi trafficking and therefore
prevents trafficking of proteins beyond the cis-Golgi
(Klausner et al., 1992
; Lippincott-Schwartz et al., 1992),
this result indicates that most of the reporter protein molecules must transverse the Golgi on their path to the prevacuole for proaleurain processing.
The BP-80 TMD Is Sufficient and Specific for Targeting of the Reporter Protein to the Site of Proaleurain Processing
In yeast, integral membrane proteins in the secretary pathway that lack alternative targeting determinants may be
directed to the vacuole (Roberts et al., 1992; Bryant and
Stevens, 1997
). Thus, dipeptidyl aminopeptidase is localized to the trans-Golgi network (TGN) by virtue of targeting determinants in its cytoplasmic domain; when the cytoplasmic domain is removed, the protein is directed to the
vacuole (Roberts et al., 1992
). We assessed the importance
of the BP-80 CT in vacuolar targeting by making a deletion series within the CT of BP-80. Each construct was
tested for proaleurain processing in tobacco protoplasts.
All constructs with various BP-80 CT deletions (500-504)
resulted in similar efficiency of proaleurain processing
within the limits of the assay (data not shown). This series
of experiments is summarized by the result obtained when
a complete deletion of the CT (construct 500) was expressed and compared with the result obtained with the intact construct (construct 491). Similar amounts of mature
aleurain were detected in the CS fraction from these two
constructs (Fig. 4, single asterisk, compare lane 1 with lane
3). These results demonstrate that the TMD of BP-80 is
sufficient for targeting to the site of proaleurain processing. Interestingly, when the BP-80 TMD was replaced by
the
-TIP COOH-terminal TMD and the resulting construct (539) was expressed in tobacco protoplasts, no mature aleurain was detected in the CS fraction (Fig. 4, lane 5). This result indicates that not all TMDs are capable of
directing the reporter protein to the site of proaleurain
processing, and indicates the specificity of the BP-80 TMD
for prevacuolar targeting (see Discussion). When the BP-80 CT was attached to the
-TIP TMD and the resulting
construct (540) was expressed in tobacco protoplasts, no
mature aleurain was detected in the CS fraction (Fig. 4,
lane 7), indicating that the BP-80 CT could not override the
-TIP TMD determinant to cause lytic prevacuolar
targeting.
The CT of -TIP Prevents Traffic to the Prevacuolar
Site of Proaleurain Processing
We studied traffic to the lytic vacuolar compartment
where aleurain is localized (Paris et al., 1996). The second
vacuolar compartment, the PSV is marked by the presence
of
-TIP in its tonoplast membrane (Johnson et al., 1989
;
Paris et al., 1996
). Although a separate PSV has not been
identified in tobacco leaf or suspension culture cells, a distinct pathway for soluble proteins that would be sorted to
the PSV has been defined in tobacco suspension culture
cells (Matsuoka et al., 1995
). Studies where a chimeric reporter protein containing the
-TIP COOH-terminal
TMD and 17-amino acid CT was expressed in transgenic
tobacco suggested that those portions of
-TIP were sufficient to direct the reporter to vacuole tonoplast in tobacco
leaf cells (Höfte and Chrispeels, 1992
).
We therefore tested whether the CT of -TIP could
modify the traffic of our reporter construct, where the BP-80 TMD alone was sufficient to direct the reporter to the
lytic prevacuolar compartment for proaleurain processing.
To avoid altering any of the structural features of the BP-80 TMD, as a template we used construct 501 (Table II)
that retains five BP-80 CT residues. As a control, we compared the effect of attaching the terminal 14 amino acids
from the CT of a maize homologue of BP-80 (Paris et al.,
1997
) as well as the 12-amino acid
-TIP COOH-terminal CT (Höfte et al., 1992
). When expressed in tobacco protoplasts, similar amounts of mature aleurain were observed
in the CS fraction for both constructs 513 (BP-80 TMD-maize CT) and 575 (BP-80 TMD-
-TIP CT), when compared with 491 (BP-80 TMD-CT) (Fig. 5 A, asterisks, compare lanes 1 and 3 with lane 5), indicating that neither the maize CT nor the
-TIP CT affect prevacuolar targeting of
the reporter proteins. These results demonstrate that attachment of different peptide sequences to the first five
residues, KYRIR, of the BP-80 CT does not cause misfolding of the reporter protein such that traffic to the site
of processing is demonstrably affected. In contrast, when
the
-TIP CT was attached to the first five residues of the
BP-80 CT and the resulting construct (526) expressed in
tobacco protoplasts, no mature aleurain was detected in
the CS fraction (Fig. 5 A, Construct 526, lane 9). Because
the BP-80 TMD alone (Fig. 4, Construct 500) was sufficient for prevacuolar targeting, we conclude that the CT of
-TIP contains positive information that prevents traffic
to the prevacuolar site of proaleurain processing. Consistent with this result, the replacement of both the BP-80
TMD and CT with the
-TIP TMD and CT (Fig. 4, Construct 527) also resulted in no processing of proaleurain
(Fig. 5 A, lane 7). The 29-kD band (Fig. 5 A, double asterisks) visible in some of the immunoprecipitates was a tobacco endogenous protein that was also detected in untransformed protoplasts (Holwerda et al., 1992
) (data not
shown).
|
We determined that little of the -TIP CT reporter protein (Fig. 5 A, Construct 526) reaches the Golgi by immunoprecipitating with anti-plant complex Asn-linked glycan
antibodies from cell extracts expressing either the BP-80
TMD/CT reporter (Fig. 5 A, Construct 491) or the BP-80
TMD-
-TIP CT reporter (Fig. 5 A, Construct 526) proteins. Consistent with previous results (Fig. 3 A), aleurain and plant complex Asn-linked glycan antibodies detected
the full-length reporter protein (Fig. 5 B, arrow at right,
lanes 1 and 2) in cells expressing the BP-80 TMD/CT reporter (Fig. 5 B, Construct 491). Similar results were obtained in cells expressing constructs 500 and 501 (see Table II for summarized results). In contrast, consistent with
results in Fig. 5 A, from cells expressing the BP-80 TMD-
-TIP CT reporter protein (Fig. 5 A, Construct 526), anti-aleurain antibodies detected only the full-length reporter protein (Fig. 5 A, lane 3), and very little of this full-length reporter protein was immunoprecipitated by the anti-plant
complex Asn-linked glycan antibodies (Fig. 5 A, arrow at
right, lane 4). Thus, the
-TIP CT prevents the reporter
protein from reaching the Golgi cisternae where complex
modifications to Asn-linked glycans occur.
These results are summarized in Table II, where the ability of a given TMD and/or CT sequence to permit trafficking of the reporter protein to the Golgi and to the site of proaleurain processing is defined.
The BP-80 CT May Be Important in Recycling from the Lytic Prevacuolar Compartment Back to the Golgi
The above results demonstrate that the BP-80 TMD alone
is sufficient and specific for targeting the fusion protein to
the prevacuole for proaleurain processing. In yeast it has
been shown that the CT of the vacuolar sorting receptor
Vps10p is important for its stability and recycling back to
the Golgi (Cereghino et al., 1995). A truncated form lacking a CT is more rapidly degraded because it cannot recycle from the yeast prevacuolar compartment. To test the
possibility that the BP-80 CT has a similar role, we performed pulse-chase and immunoprecipitation studies in
comparing the half-life of intact BP-80 (WT BP-80) to a
truncated form of BP-80 missing its CT (BP-80
CT). As
shown in Fig. 6 (arrow at left, lanes 1-3), the half-life for
the intact BP-80 protein expressed in tobacco protoplasts
was >2 h, with ~80% of the original protein remaining after 1 and 2 h of chase (Fig. 6, compare lane 1 with 2 and 3).
In contrast, the stability of the BP-80
CT protein was
substantially reduced, with a half-life less than 1 h: as assessed by PhosphorImager analysis, 46 and 24% remained
after 1 and 2 h of chase, respectively (Fig. 6,
at right,
compare lane 4 with 5 and 6). These results support the hypothesis that the BP-80 CT may be important in recycling
back to the Golgi.
|
|
Confocal Immunofluorescence Localization of Reporter Proteins in Tobacco Protoplasts
The biochemical data presented above demonstrate that
the BP-80 TMD/CT directs the reporter protein to the
prevacuole via the Golgi complex, whereas the -TIP
TMD and/or CT prevent both traffic through the Golgi
and prevacuolar targeting. It was important to determine
if the BP-80 TMD/
-TIP CT construct (526) simply remained in the ER, or if it moved from the ER to a different organelle. Therefore, we used confocal laser scanning
microscopy and immunofluorescence to compare the intracellular localization of different reporter proteins to
that of Golgi/lytic prevacuole as defined by tobacco VSR
protein homologous of BP-80, and to ER as defined by
calnexin and BiP.
Before confocal immunofluorescence studies were performed, we tested different antibodies for their cross-reactivity and specificity in tobacco cells by means of immunoprecipitation from extracts of control (transformed with
control plasmid pBI221) tobacco cells. As a molecular
marker, we also expressed the intact pea BP-80 (construct 472) (Paris et al., 1997) for immunoprecipitation. As
shown in Fig. 7, a monoclonal antibody (14G7 VSR)
against BP-80 detected two bands of 80 and 72 kD in size
from tobacco protoplast extracts (Fig. 7, lane 1). In pumpkin cotyledons, BP-80 homologues that bind the proaleurain vacuolar targeting sequence exist as 72- and 82-kD
proteins (Shimada et al., 1997
) and these results with the
14G7 VSR monoclonal antibody indicate that, similarly, VSR proteins of two different sizes are expressed in the
tobacco suspension culture cells. The relative abundance
of the 80- and 72-kD bands detected by 14G7 was quantitated by sequential immunoprecipitation using the same
antibody followed by immunoprecipitation with a second
anti-BP-80 monoclonal, 17F9. The second immunoprecipitation of the series with 14G7 again selected the 72-kD
form of the protein but little of the 80-kD form (Fig. 7,
lane 2). A third immunoprecipitation, this time using 17F9,
selected only the 72-kD form (Fig. 7, lane 3). When the
stepwise order of sequential immunoprecipitation was reversed, with 17F9 used in the first two steps and 14G7 in the last step (Fig. 7, lanes 4-6), similar results were obtained: the 72-kD form was selected in all steps, whereas
only 14G7 selected the 80-kD form. These results were
specific because a control monoclonal antibody for aleurain, 1G6 (Rogers et al., 1997
), did not select either the 72- or the 80-kD proteins (Fig. 7, lanes 7 and 8), but 14G7
again selected both proteins at the last step (Fig. 7, lane 9).
As a size marker, 78-kD BiP was immunoprecipitated from the tobacco protoplast extract (Fig. 7, lane 12); this
result is similar to that obtained by others (Pedrezzini et al.,
1997
). The 80-kD BP-80 protein was immunoprecipitated
from extracts of protoplasts expressing that protein (construct 472) using the RA3 antipeptide polyclonal antibodies (Fig. 7, lane 11) that do not recognize the tobacco BP-80 homologues (Fig. 7, lane 10) (Paris et al., 1997
).
To determine the cross-reactivity of various antibodies
for tobacco proteins, we performed immunofluorescence
studies in tobacco protoplasts expressing the control plasmid pBI221. As shown in Fig. 8 A, no signal was obtained
in control cells double labeled with mouse monoclonal
FLAG and aleurain rabbit polyclonal antibodies, detected
with Cy5 and rhodamine labeled secondary antibodies, respectively, even when a 30% laser intensity was used to
collect the image. In contrast, when the FLAG monoclonal and calnexin rabbit polyclonal antibodies were incubated with control cells and detected with rhodamine-
and Cy5-labeled secondary antibodies, respectively, intense labeling with calnexin was obtained with 1% laser
intensity (as shown by the green pattern in a typical ER
distribution) whereas no FLAG labeling was detected
(Fig. 8 B). Similarly, when aleurain rabbit polyclonal and
the 14G7 anti-VSR mouse monoclonal antibodies were
detected by rhodamine- and Cy5-labeled secondary antibodies, respectively, only a Cy5 punctate pattern typical
for VSR proteins (Paris et al., 1997) was obtained (Fig. 8
C, green). Indistinguishable results were obtained when
the 17F9 anti-VSR monoclonal antibody was used, although its staining pattern was somewhat less intense.
These results establish that endogenous tobacco cell antigens
recognized by the anti-VSR monoclonals and by anti-calnexin and anti-BiP (data not shown) polyclonal antibodies
were readily visualized such that the image intensity was
within the linear range of the detector when only small
amounts of laser excitation (0.3-1%) were used. In contrast, antibodies to FLAG, aleurain, and a peptide representing the
-TIP CT (Jauh et al., 1998
) did not give signals from control protoplasts even when much greater
levels of laser excitation (30%) were used. Therefore, to
detect FLAG, aleurain, and
-TIP CT antigens in protoplasts expressing the reporter proteins, only cells were analyzed where the signals from their antibodies were elicited by a maximum laser intensity of 1%.
|
The ability of the system to measure true colocalization
was then tested in protoplasts expressing the reporter proteins by double labeling with two antibodies to antigens on
the same protein. For simplicity's sake, reporter 491 with
the BP-80 TMD/BP-80 CT is designed Re-F-B-B (reporter-
FLAG-BP-80-BP-80), and reporter 526 with the BP-80
TMD/-TIP CT is designed Re-F-B-
(reporter-FLAG-BP- 80-
-TIP). As shown in Fig. 8, D and E, in protoplasts expressing either Re-F-B-B or Re-F-B-
, strong Cy5 signals
for FLAG (green) and rhodamine signals for aleurain (red)
were detected with 1% laser intensity, and superimposition of the two images (right panels) showed essentially
full colocalization of the signals as indicated by the yellow
color. Similar results were obtained when cells expressing
Re-F-B-
were double labeled with anti-FLAG and anti-
-TIP CT antibodies (Fig. 8 F). Quantitation of the extent
of colocalization (Materials and Methods) for aleurain and
FLAG on the two constructs (Table III, lines 1-3) confirmed the visual impression and demonstrated that results
with the two constructs were statistically indistinguishable
(P = 0.6). We concluded that both FLAG monoclonal and
aleurain polyclonal antibodies recognize the same reporter
protein in transformed tobacco protoplasts, regardless of
the reporter CT sequence, and therefore either of the antibodies could be used to detect the reporter protein.
We then determined the frequency with which the Re-F-B-B reporter protein, detected with anti-aleurain polyclonal antibodies, colocalized with tobacco VSR proteins detected with either the 14G7 or the 17F9 monoclonal antibodies. As shown in Fig. 9, A and B, much of the aleurain signals (red) colocalized with either of the VSR signals (green), as demonstrated by the extensive amount of yellow in the superimposed images (right panels).
|
The extent of colocalization quantitated for anti-aleurain and 14G7 anti-VSR was 74 ± 15% (mean ± SD, n = 16; Table III, line 4), and for anti-aleurain and 17F9 anti-VSR was 73 ± 25 (n = 12; Table III, line 6). In contrast,
much different results were obtained when anti-aleurain
marking the Re-F-B- reporter was compared with the tobacco VSR proteins (Fig. 9 C). For this reporter, colocalization with 14G7 anti-VSR was 17 ± 13% (n = 13, Table
III, line 5) and with 17F9 anti-VSR was 8 ± 2% (n = 11;
Table III, line 7). The differences obtained between the
Re-F-B-B and Re-F-B-
reporters were highly significant
(Table III) and establish that Re-F-B-B was closely associated with compartments containing tobacco VSR proteins,
whereas Re-F-B-
had little or no association with these compartments.
These results are consistent with the biochemical analyses documented above, where the Re-F-B- reporter (construct 526) did not transit through the Golgi and did not
reach the site of proaleurain processing. We then asked if
this reporter was retained in the ER or if it instead moved
from the ER to some other organelle compartment. We
used antibodies to calnexin and to BiP to identify ER in
immunofluorescence analyses because published data indicated that these proteins are distributed throughout ER
and are present in functionally different ER subdomains
(Okita and Rogers, 1996
). As shown in Fig. 9 D, the Re-F-B-B reporter showed little colocalization with calnexin.
Similar results were obtained with the Re-F-B-
reporter
(Fig. 9 E). Quantitation of either reporter relative to calnexin (Table III, lines 8 and 9) or relative to BiP (Table III, lines 10 and 11) showed less than 10% colocalization in
every instance, with no statistically significant difference
between the two reporter proteins.
These results demonstrate that both reporter proteins
exit the ER but to different destinations. The BP-80 TMD/
CT (Re-F-B-B) reporter protein is localized in the same
pathway as the tobacco VSR proteins, whereas the BP-80
TMD--TIP CT (Re-F-B-
) reporter protein follows a different pathway to a destination beyond the ER.
The Re-F-B- Reporter Protein Traffics from
ER to Vacuoles
Subcellular fractionation was used to characterize organelles containing the Re-F-B- reporter. We used a simple protocol where vacuoles, because of their low buoyant
density, remain at the top interface of a Ficoll cushion
when centrifuged at 170,000 g for 2 h, whereas ER and
Golgi pellet to the bottom of the tube. We tested the specificity of the fractionation procedure with protoplasts
expressing soluble proaleurain that were continuously labeled with [35S]Met + Cys for 3 h. Consistent with
previous results (Holwerda et al., 1992
), 90% of proaleurain was localized in the P fraction (Fig. 10 A, single dot,
lanes 1 and 2), whereas 93% of mature aleurain was in the
V fraction (Fig. 10 A, asterisk, lanes 1 and 2). In all experiments, no reporter proteins were detected dispersed in the
buffer solution overlaying the Ficoll gradient, indicating that all endomembrane compartments remained intact
during the fractionation procedure (data not presented).
When a similar fractionation was performed on protoplasts expressing the Re-F-B-B reporter construct, the soluble mature aleurain doublet (Fig. 10 A, asterisk, lane 3)
was exclusively immunoprecipitated from the V fraction. Abundant amounts of the full-length reporter protein
present in the V fraction (Fig. 10 A, arrow, lane 3) presumably are due to a relatively slow rate or efficiency of processing of the proaleurain moiety in the reporter. In contrast, and consistent with previous results, in protoplasts
expressing the Re-F-B-
reporter, no mature aleurain was
immunoprecipitated from the V fraction (Fig. 10 A, lane
5), and full-length reporter protein was present in both V
and P fractions (Fig. 10 A, lanes 5 and 6). The specificity of the fractionation procedure for the Re-F-B-
reporter was
further assessed by pulse-chase experiment analysis. As
shown in Fig. 10 A, lanes 7-10, at the end of a 1-h pulse,
90% of the Re-F-B-
reporter protein remained in the P
fraction (Fig. 10 A, arrow, lane 8), whereas only 10% was
found in the V fraction (Fig. 10 A, lane 7). In contrast, after a 2-h chase, 71% of the full-length reporter protein was
now recovered from the V fraction (Fig. 10 A, lane 9),
whereas the amount of full-length reporter present in the
P fraction was reduced to 29% (Fig. 10, arrow, lane 10). The specificity of this subcellular fractionation procedure
was further documented by immunoprecipitating the tobacco VSR proteins, markers for Golgi and lytic prevacuoles, and the ER markers BiP and calnexin (Fig. 10 B).
The VSR proteins (Fig. 10 B, lanes 1, 2, 5, and 6) were predominantly recovered from the V fraction, whereas 90%
of BiP (Fig. 10 B, lanes 7 and 8) and calnexin (Fig. 10 B,
lanes 9 and 10) were recovered from the P fraction. These data demonstrate that the Re-F-B-
reporter moved from
the ER to a vacuole-like compartment as defined by its
buoyant density, whereas only a small amount remained
with ER and Golgi after the 2-h chase. Importantly, and
consistent with confocal immunofluorescence results (Fig.
9), even though both Re-F-B-
and Re-F-B-B reporters were localized to the V fraction, they were in separate organelles because processing of the proaleurain moiety occurred only on the Re-F-B-B reporter.
|
The Re-F-B- Reporter Protein Colocalizes
with
-TIP Protein When They Are Coexpressed in
Tobacco Protoplasts
The bean -TIP protein was found to be localized in vacuoles when expressed in transgenic tobacco leaf cells (Gomez and Chrispeels, 1993
). We asked if the Re-F-B-
reporter and
-TIP protein colocalized when expressed
together in tobacco protoplasts. In preliminary experiments, the anti-
-TIP protein antibodies efficiently immunoprecipitated the 26-kD
-TIP protein when it was expressed in tobacco protoplasts. It was localized exclusively
in the CM fraction, and its distribution between V and P
fractions in the subcellular fractionation procedure was indistinguishable from that obtained with the Re-F-B-
reporter (data not presented). In contrast, the anti-
-TIP
protein antibodies immunoprecipitated only small amounts
of expressed Re-F-B-
reporter (data not presented).
These results indicated that a small fraction of the anti-
-TIP protein antibodies recognized the
-TIP CT sequence. Therefore, in immunoconfocal experiments, we
blocked the anti-
-TIP protein antibodies with a large
amount of
-TIP CT peptide. The following data demonstrate that, under these circumstances, the anti-
-TIP protein antibodies recognized only
-TIP protein but not Re-F-B-
reporter.
We compared the localization of Re-F-B- reporter and
-TIP protein using double-label immunofluorescence in
protoplasts expressing these two proteins. Anti-FLAG
monoclonal antibodies and rhodamine-conjugated anti-mouse secondary antibodies were used to detect the Re-F-B-
reporter; whereas anti-
-TIP protein antibodies
and Cy5-conjugated anti-rabbit secondary antibodies were
used to detect the expressed
-TIP protein. As shown in
Fig. 11 A, in protoplasts expressing only the Re-F-B-
reporter, a strong signal for FLAG (red) was detected with
1% laser intensity, whereas the anti-
-TIP protein antibodies (green) identified only occasional, scattered punctate spots. Superimposition of these two images (Fig. 11 A,
right panel) showed little colocalization of the signals; we
therefore concluded that the anti-
-TIP protein antibodies had a low level of cross-reactivity with an endogenous
tobacco protein. In contrast, in protoplasts expressing
both Re-F-B-
reporter and the bean
-TIP protein (Fig. 11 B), strong signals for FLAG (red) and
-TIP (green)
were both detected with 3% laser intensity, and superimposition of the two images showed extensive colocalization of the signals as indicated by the yellow color. The
extent of colocalization for anti-FLAG and anti-
-TIP
protein antibodies was 81 ± 22% (n = 26, Table III, line
12). Therefore the
-TIP protein and the Re-F-B-
reporter were predominantly present in the same organelles
when expressed together in tobacco protoplasts.
|
![]() |
Discussion |
---|
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
---|
In contrast to the more intensively studied yeast and mammalian systems, little is known about traffic of integral
membrane proteins within the plant cell secretory pathway. The fact that plant cells may contain two functionally
distinct vacuolar compartments (Paris et al., 1996) indicates an additional level of complexity to the system. It
will be of considerable interest to learn how both soluble
and integral membrane proteins destined for one of the
two separate vacuolar compartment are sorted into the
correct pathway, and to learn the physical characteristics
of each pathway. Although PSVs have been identified
morphologically only in seeds and root tip cells (Okita and
Rogers, 1996
), biochemical evidence indicates the presence of two separate vesicular pathways for traffic of soluble proteins to the vacuole in tobacco suspension culture
cells (Matsuoka et al., 1995
). One pathway is specific for
storage proteins, such as barley lectin, that are known to be localized to PSVs in root tip cells (Paris et al., 1996
),
while the other is specific for proteins, such as sweet potato prosporamin, that traffic to the LV (Okita and Rogers, 1996
). When barley lectin and prosporamin were coexpressed in transgenic tobacco plants, the proteins were
found together in central vacuoles of leaf and root cells
(Schroeder et al., 1993
). Thus, the two pathways appear ultimately to converge on the central vacuole in cells such as those used in our experiments, but evidence for the existence of prevacuolar, intermediate compartments for each
of the pathways in pea root tip cells and developing pea
cotyledons has recently been presented (Paris et al., 1997
;
Robinson et al., 1998
).
With respect to the LV pathway, we have purified,
cloned, and characterized a protein from developing peas,
BP-80, with characteristics expected for a vacuolar sorting
receptor (Kirsch et al., 1994; Paris et al., 1997
). BP-80 traffics in CCV from the Golgi to a prevacuolar compartment
for the LV (Paris et al., 1997
). The cysteine protease, aleurain, is synthesized as a proenzyme and processed to mature form in an acidified, post-Golgi compartment (Holwerda et al., 1990
). All evidence indicates that BP-80 is
responsible for binding proaleurain in the Golgi and delivering it to the lytic prevacuolar compartment where it is
processed (Paris et al., 1997
). Mature aleurain is then accumulated vacuoles that can be identified by immunofluorescence in barley root tip cells (Paris et al., 1996
). As
proaleurain processing requires proteases with an acid pH
optimum (Holwerda et al., 1990
), and as the mature aleurain enzyme has a pH optimum of ~5 (Holwerda and
Rogers, 1992
), we designated aleurain-containing vacuoles
as LV (Paris et al., 1996
).
We are interested in understanding mechanisms by
which BP-80 traffics to its prevacuolar destination, as part
of understanding the larger picture of how integral membrane proteins are directed to different vacuoles. In this
study, we have developed and used a chimeric protein approach to study the role of the BP-80 TMD and CT in traffic to the lytic prevacuolar compartment. In particular, we
tested a chimeric reporter protein where a mutated form
of proaleurain lacking efficient vacuolar targeting determinants was attached via a linker to the short Ser/Thr-rich
domain-TMD-CT of BP-80. When expressed in tobacco
protoplasts, this reporter protein (proaleurain-linker-TMD-
CT of BP-80 or Re-F-B-B) moved to a site where the
proaleurain portion was processed to mature aleurain,
while, apparently simultaneously, the processed aleurain was released from membrane association by cleavage
within the linker sequences. We assume that processing of
the proaleurain moiety occurred in the prevacuolar compartment and not the central vacuole because BP-80 appears to be limited to prevacuoles (Paris et al., 1997), and
because we never observed fluorescence from the anti-aleurain antibodies in the tonoplast of the central vacuole or its contents. (Prevacuolar processing of proaleurain is
also consistent with what is known in yeast, where the prevacuolar compartment contains active proteases [Bryant
and Stevens, 1997
].) The latter negative results must be interpreted with caution, however, because dilution of the
processed protein into a larger volume may have limited
our ability to detect it. For the purposes of this study, the
organelle(s) where proaleurain is processed and where
mature aleurain accumulates is defined as the LV. Given the complexity of vacuoles (see below), we argue that
these biochemical functions provide a precise definition
for this compartment.
BP-80 is abundant in highly purified pea CCV lacking
immunologically detectable storage proteins (Robinson
et al., 1998), and its CT contains YMPL, a YXX
motif.
The YXX
motif is known to be important for binding of
clathrin adaptor proteins during CCV assembly (Ohno
et al., 1995
; Marks et al., 1997
). It was therefore puzzling
that a reporter construct with only the BP-80 TMD and lacking a CT was transported to the lytic prevacuole for
proaleurain processing as efficiently as the intact construct. We do not know if the construct lacking a CT also
traffics in CCV, but our assay only measures forward traffic and we hypothesize that the CT would be important in
retrieval from the prevacuoles to Golgi via CCV. The latter premise is indicated by our finding that BP-80 lacking a
CT is much less stable than the intact receptor when expressed in tobacco protoplasts. In this regard our results
are similar to those obtained in studies of the yeast Vps10p
vacuolar sorting receptor (Marcusson et al., 1994
; Cereghino et al., 1995
), which is otherwise unrelated to BP-80.
Intact Vps10p, and Vps10p lacking a cytoplasmic tail rapidly exit the TGN at the same rate, and localization of intact Vps10p to the TGN is thought to be due to an active
retrieval process (Bryant and Stevens, 1997
). Our results,
plus those from Vps10p studies, indicate that prevacuole to Golgi retrieval may occur in CCV, but it is not clear if
CCV are necessary for Golgi to prevacuole traffic.
It was important to learn if traffic of the reporter protein
carrying the BP-80 TMD to the lytic prevacuole could be
altered by attaching a CT from a protein normally resident
in a different compartment. Similarly, it was important to
learn if all TMD sequences would function to direct the reporter protein to the same destination. We therefore chose
to test the TMD and CT sequences from -TIP, a protein
resident in PSVs.
To avoid altering the BP-80 TMD when attaching CT
sequences from other proteins, we used a construct that
carried the 24-amino acid BP-80 TMD plus five residues,
KYRIR, on the cytoplasmic side. This construct, 501, trafficked to the lytic prevacuole as efficiently as either the
full-length construct, 491, or construct 500 with complete
deletion of CT sequences (Table II). When the 17-amino acid -TIP CT was attached to make Re-F-B-
, no processing of the reporter proaleurain moiety was observed
(Table II), and immunofluorescence studies showed that it
was neither present in organelles carrying the tobacco
VSR homologous (Golgi and lytic prevacuoles), nor in the
ER as defined by the presence of calnexin and BiP. This result was specific to the
-TIP CT sequences because a
control construct, where the 12-amino acid COOH-terminal
-TIP CT sequence was similarly attached to make
construct 513, trafficked normally (Table II). In other
studies,
-TIP was localized to LV and
-TIP to PSV
(Paris et al., 1996
) (Jauh, G.-Y., and J.C. Rogers, unpublished data). Thus, the
-TIP CT carries positive information that overrides the ability of the BP-80 TMD to direct
the reporter protein to the lytic prevacuole pathway,
whereas the
-TIP CT, normally present in LV, does not
alter this traffic.
Together, results from immunoprecipitation and immunofluorescence studies indicated that the Re-F-B- reporter protein did not transit the Golgi but instead moved
through a different pathway to a destination beyond the
ER. Subcellular fractionation studies demonstrated that
70% of the newly synthesized Re-F-B-
that was labeled
in a 1-h pulse moved from an ER/Golgi fraction to a vacuole fraction within the 2-h chase period. The definition of
the vacuole fraction in this procedure was very stringent. It
required the organelles to remain at the interface between
buffer and a 12% Ficoll cushion during centrifugation at
170,000 g; thus, these organelles must have a high ratio of
lumenal water to protein. As we did not observe the Re-F-B-
protein in the central vacuole tonoplast in confocal
immunofluorescence experiments, we hypothesize that it
was primarily present in small vacuoles that are part of the
PSV pathway in the tobacco cells. Consistent with this hypothesis, when
-TIP protein was coexpressed with the
Re-F-B-
reporter, the two proteins were largely localized
together as assessed by confocal immunofluorescence.
Our results in general are consistent with those of Höfte
et al. (1992)
, who showed in transgenic tobacco leaf cells
that a chimeric protein carrying the COOH-terminal
TMD and CT of
-TIP trafficked to a vacuolar location.
Additionally, studies of intact
-TIP expressed in transgenic tobacco leaf mesophyll cells indicated that its movement from ER to vacuole was not affected by BFA (Gomez and Chrispeels, 1993
). An explanation to unify the
results of all of these studies would be a direct pathway
from ER to the PSV or its equivalent in mesophyll cells. It
will be of considerable interest to characterize biochemically the vacuoles specified by the
-TIP CT sequences,
and to identify cytoplasmic proteins that interact with
those sequences to direct it to its destination. Efforts to resolve these questions are currently under way in our laboratory.
We also found that substituting the -TIP COOH-terminal TMD for the BP-80 TMD prevented traffic to the
lytic prevacuole, regardless of the presence or type of CT
sequences attached. This result is not due to misfolding of
the reporter protein caused by substitution of a different
TMD sequence because mutation of the Glu residue at position 19 to Leu in the
-TIP TMD (see below) allowed
the reporter to move normally to the site of proaleurain
processing (data not shown). These results also demonstrate that traffic to the lytic prevacuole is not a default
pathway for all integral membrane proteins carrying a single TMD and lacking a CT. Thus, the physical structure of
the TMD sequences is an important determinant for subcellular localization in plant cells.
This conclusion is consistent with detailed studies of the
role of TMD sequences in localization of integral membrane proteins within the yeast secretory pathway (Sato
et al., 1996; Rayner and Pelham, 1997
). In general, in these
studies, TMD-mediated localization was in part dependent
upon TMD length, where long sequences (
24 residues)
were needed to allow transport to the cell surface. Shorter
sequences could be localized to ER, Golgi, or endosome/
vacuole, depending upon the specific sequences involved (Rayner and Pelham, 1997
). Localization to the ER was
dependent upon specific physical characteristics of the
TMD sequences and had features suggesting that a specific receptor might be involved (Sato et al., 1996
; Rayner
and Pelham, 1997
).
There are striking differences between the TMDs of BP-80 and -TIP used in our studies. BP-80 has 24 hydrophobic residues comprising the predicted TMD that are
bracketed by two Lys residues (Table II). Although the
COOH-terminal TMD of
-TIP used in this study had
previously been described to comprise 23 residues (Höfte and Chrispeels, 1992
) (Table II), it has a highly charged
Glu residue at position 19 (Table II). One would question
whether this Glu would be within a lipid bilayer, but this
occurrence has been described in other proteins (Lanier et
al., 1998
). Even if the Glu is excluded from the lipid bilayer, this
-TIP TMD may consist of 18 residues, a length
adequate to span many organelle membranes when compared with the 16-residue ER localized Ufe1p, 16-residue
Golgi-localized Sed5p, and 19-residue endosome-localized Pep12p yeast TMD sequences (Rayner and Pelham, 1997
).
It will be important in the future to clarify if the length of
the
-TIP TMD is important in preventing traffic of our
reporter protein to the lytic prevacuole.
To clarify whether our reporter protein carrying BP-80
TMD/CT sequences, Re-F-B-B, transited the Golgi en
route to the lytic prevacuole, we determined that it acquired Golgi-specific modifications to Asn-linked glycans,
and that BFA prevented its traffic to the lytic prevacuole.
Additionally its distribution in tobacco protoplasts was
tightly associated with the tobacco VSR proteins, markers for Golgi and lytic prevacuoles. All of these results are
consistent with what is known of the subcellular location
of BP-80 (Paris et al., 1997), from which the TMD and CT
of our reporter protein were derived. We are therefore
confident that the Re-F-B-B reporter protein follows an
ER to Golgi to prevacuole pathway in tobacco cells. We
recognize, however, that the reporter protein assays only
the roles of the TMD and CT. We cannot exclude the possibility that the VSR proteins (Paris et al., 1997
), of which
BP-80 is a member, may form homo- or heterocomplexes,
and that these complexes could alter the traffic of the proteins in ways not predicted by results reported here.
In conclusion, our studies present the first evidence for separate roles of TMD and CT sequences in sorting of integral membrane proteins from ER into the lytic vacuole pathway or into a pathway associated with a PSV equivalent in plant cells. Further studies of pathways taken by proteins destined to each specific vacuolar compartment may lead to a better understanding not only of how sorting to each separate vacuole type occurs, but also of how cells can generate and maintain the two separate compartments. These appear to be unique processes in plant cells that are not available for study in other systems.
![]() |
Footnotes |
---|
Address correspondence to J.C. Rogers, Institute of Biological Chemistry, Washington State University, Pullman, WA 99164-6340. Tel.: (509) 335-2773. Fax: (509) 335-7643. E-mail: bcjroger{at}wsu.edu
Received for publication 11 May 1998 and in revised form 4 September 1998.
We greatly appreciate the assistance from S. Rogers (Washington State
University, Pullman, WA) in many ways during the course of this work
and thank M.J. Chrispeels (University of California, San Diego, CA) for
sharing the -TIP cDNA and anti-
-TIP protein antiserum, and S.J.
Coughlan (Pioneer Hi-Bred International, Johnston, IA), D.J. Meyer
(Washington State University), and A. Bennet (University of California,
Davis, CA), and A. Sturm (Friedrich Miescher Institute, Basel, Switzerland) for sharing other antisera used in this study. Special thanks are given
to X.-F. Cao and G.-Y. Jauh (both from Washington State University) for
making available the 17F9 monoclonal antibody to BP-80 and polyclonal
antibodies to the
-TIP CT peptide.
This research was supported by grants from the National Institutes of
Health (GM 52427) and the Department of Energy (DE-FG 95ER
20165).
![]() |
Abbreviations used in this paper |
---|
BFA, brefeldin A; CCV, clathrin-coated vesicles; CM, cell membrane fraction; CS, cell soluble fraction; CT, cytoplasmic tail; LV, lytic vacuole; P, pellet fraction; PSV, protein storage vacuole; TIP, tonoplast intrinsic protein; TMD, transmembrane domain; V, vacuole fraction; VSR, vacuolar sorting receptor.
![]() |
References |
---|
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
---|
1. |
Bryant, N.J., and
T.H. Stevens.
1997.
Two separate signals act independently to
localize a yeast late golgi membrane protein through a combination of retrieval and retention.
J. Cell Biol.
136:
287-297
|
2. | Cereghino, J.L., E.G. Marcusson, and S.D. Emr. 1995. The cytoplasmic tail domain of the vacuolar protein sorting receptor Vps10p and a subset of VPS gene products regulate receptor stability, function, and localization. Mol. Biol. Cell. 6: 1089-1102 [Abstract]. |
3. |
Gomez, L., and
M.J. Chrispeels.
1993.
Tonoplast and soluble vacuolar proteins
are targeted by different mechanisms.
Plant Cell.
5:
1113-1124
|
4. | Guy, M., L. Reinhold, and D. Michaeli. 1979. Direct evidence for a sugar transport mechanism in isolated vacuoles. Plant Physiol 64: 61-64 . |
5. | Hinz, G., B. Hoh, I. Hohl, and D.G. Robinson. 1995. Stratification of storage proteins in the protein storage vacuole of developing cotyledons of Pisum sativum L. J. Plant Physiol. 145: 437-442 . |
6. |
Höfte, H., and
M.J. Chrispeels.
1992.
Protein sorting to the vacuolar membrane.
Plant Cell.
4:
995-1004
|
7. | Höfte, H., L. Hubbard, J. Reizer, D. Ludevid, E.M. Herman, and M.J. Chrispeels. 1992. Vegetative and seed-specific forms of tonoplast intrinsic protein in the vacuolar membrane of Arabidopsis thaliana. Plant. Physiol. 99: 561-570 . |
8. |
Hohl, I.,
D.G. Robinson,
M.C. Chrispeels, and
G. Hinz.
1996.
Transport of storage proteins to the vacuole is mediated by vesicles without a clathrin coat.
J.
Cell Sci.
109:
2539-2550
|
9. | Holwerda, B.C., and J.C. Rogers. 1992. Purification and characterization of aleurain: a plant thiol protease functionally homologous to mammalian cathepsin H. Plant Physiol. 99: 848-855 . |
10. |
Holwerda, B.C.,
N.J. Galvin,
T.J. Baranski, and
J.C. Rogers.
1990.
In vitro processing of aleurain, a barley vacuolar thiol protease.
Plant Cell.
2:
1091-1106
|
11. |
Holwerda, B.C.,
H.S. Padgett, and
J.C. Rogers.
1992.
Proaleurain vacuolar targeting is mediated by short contiguous peptide interactions.
Plant Cell.
4:
307-318
|
12. |
Jauh, G.Y.,
A.M. Fisher,
H.D. Grimes,
C.A. Ryan, and
J.C. Rogers.
1998.
![]() |
13. | Jefferson, R.A., T.A. Kavanaugh, and M.W. Bevan. 1987. GUS fusions: beta-glucuronidase as a sensitive and versatile gene fusion marker in higher plants. EMBO (Eur. Mol. Biol. Organ.) J. 6: 3901-3907 [Abstract]. |
14. | Johnson, K.D., E.M. Herman, and M.J. Chrispeels. 1989. An abundant, highly conserved tonoplast protein in seeds. Plant Physiol. 91: 1006-1013 . |
15. |
Jungmann, J., and
S. Munro.
1998.
Multi-protein complexes in the cis Golgi of
Saccharomyces cerevisiae with ![]() |
16. | Kirsch, T., N. Paris, J.M. Butler, L. Beevers, and J.C. Rogers. 1994. Purification and initial characterization of a potential plant vacuolar targeting receptor. Proc. Natl. Acad. Sci. USA. 91: 3403-3407 [Abstract]. |
17. | Klausner, R.D., J.G. Donaldson, and J. Lippincott-Schwartz. 1992. Brefeldin A: insights into the control of membrane traffic and organelle structure. J. Cell Biol. 116: 1071-1080 |
18. | Lanier, L.L., B.C. Corliss, J. Wu, C. Leong, and J.H. Phillips. 1998. Immunoreceptor DAP12 bearing a tyrosine-based activation motif is involved in activating NK cells. Nature. 391: 703-707 |
19. | Lauriér, M., M.C. Lauriér, M.J. Chrispeels, K.D. Johnson, and A. Sturm. 1989. Characterization of a xylose-specific antiserum that reacts with the complex asparagine-linked glycans of extracellular and vacuolar glycoproteins. Plant Physiol. 90: 1182-1188 . |
20. | Lippincott-Schwartz, J., L.C. Yuan, J.S. Bonifacino, and R.D. Klausner. 1989. Rapid redistribution of Golgi proteins into the ER in cells treated with brefeldin A: evidence for membrane cycling from Golgi to ER. Cell. 56: 801-813 |
21. | Marcusson, E.G., B.F. Horazdovsky, J.L. Cereghino, E. Gharakhanian, and S.D. Emr. 1994. The sorting receptor for yeast vacuolar carboxypeptidase Y is encoded by VPS10 gene. Cell. 77: 579-586 |
22. | Marks, M.S., H. Ohno, T. Kirchhausen, and J.S. Bonifacino. 1997. Protein sorting by tryosine-based signals: adapting to the Ys and wherefores. Trends Cell Biol. 7: 124-128 . |
23. | Matsuoka, K., D.C. Bassham, N. Raikhel, and K. Nakamura. 1995. Different sensitivity to wortmannin of two vacuolar sorting signals indicates the presence of distinct sorting machineries in tobacco cells. J. Cell Biol. 130: 1307-1318 [Abstract]. |
24. | Murashige, T., and F. Skoog. 1962. A revised medium for rapid growth and bioassays with tobacco tissue culture. Plant Physiol. 78: 876-882 . |
25. | Neuhaus, J.-M., and J.C. Rogers. 1998. Sorting of proteins to vacuoles in plant cells. Plant Mol. Biol. 38: 127-144 |
26. |
Nothwehr, S.F., and
T.H. Stevens.
1994.
Sorting of membrane proteins in the
yeast secretory pathway.
J. Biol. Chem.
269:
10185-10188
|
27. | Nothwehr, S.F., C.J. Roberts, and T.H. Stevens. 1993. Membrane protein retention in the yeast Golgi apparatus: dipeptidyl aminopeptidase A is retained by a cytoplasmic signal containing aromatic residues. J. Cell Biol. 121: 1197-1209 [Abstract]. |
28. | Nothwehr, S.F., E. Conibear, and T.H. Stevens. 1995. Golgi and vacuolar membrane proteins reach the vacuole in vps1 mutant yeast cells via the plasma membrane. J. Cell Biol. 129: 35-46 [Abstract]. |
29. | Ohno, H., J. Stewart, M.-C. Fournier, H. Bosshart, I. Rhee, S. Miyatake, T. Saito, A. Gallusser, T. Kirchhausen, and J.S. Bonifacino. 1995. Interaction of tyrosine-based sorting signals with clathrin-associated proteins. Science. 269: 1872-1875 |
30. | Okita, T.W., and J.C. Rogers. 1996. Compartmentation of proteins in the endomembrane system of plant cells. Annu. Rev. Plant Physiol. Plant Mol. Biol. 47: 327-350 . |
31. |
Paris, N.,
S.W. Rogers,
L. Jiang,
T. Kirsch,
L. Beevers,
T.E. Phillips, and
J.C. Rogers.
1997.
Molecular cloning and further characterization of a probable
plant vacuolar sorting receptor.
Plant Physiol.
115:
29-39
|
32. | Paris, N., and J.C. Rogers. 1996. The role of receptors in targeting soluble proteins from the secretory pathway to the vacuole. Plant Physiol. Biochem. 34: 223-227 . |
33. | Paris, N., C.M. Stanley, R.L. Jones, and J.C. Rogers. 1996. Plant cells contain two functionally distinct vacuolar compartments. Cell. 85: 563-572 |
34. |
Pedrezzini, E.,
G. Giovinazzo,
A. Bielli,
M.D. Virgilio,
L. Frigerio,
M. Pesca,
F. Faoro,
R. Bollini,
A. Ceriotti, and
A. Vitale.
1997.
Protein quality control
along the route to the plant vacuole.
Plant Cell.
9:
1869-1880
|
35. | Rayner, J.C., and H.R.B. Pelham. 1997. Transmembrane domain-dependent sorting of proteins to the ER and plasma membrane in yeast. EMBO (Eur. Mol. Biol. Organ.) J. 16: 1832-1841 [Abstract]. |
36. | Roberts, C.J., S.F. Nothwehr, and T.H. Stevens. 1992. Membrane protein sorting in the yeast secretory pathway: evidence that the vacuole may be the default compartment. J. Cell Biol. 119: 63-83 . |
37. | Robinson, D.G., B. Hoh, G. Hinz, and B.-K. Jeong. 1995. One vacuole or two vacuoles: do protein storage vacuoles arise de novo during pea cotyledon development? J. Plant Physiol. 145: 654-664 . |
38. | Robinson, D.G., M. Baumer, G. Hinz, and I. Hohl. 1998. Vesicle transfer of storage protein to the vacuole: the role of the Golgi apparatus and multivesicular bodies. J. Plant Physiol. 152: 659-667 . |
39. | Rogers, J.C., D. Dean, and G.R. Heck. 1985. Aleurain: a barley thiol protease closely related to mammalian cathepsin H. Proc. Natl. Acad. Sci. USA. 82: 6512-6516 [Abstract]. |
40. | Rogers, S.W., M. Burks, and J.C. Rogers. 1997. Monoclonal antibodies to barley aleurain and homologues from other plants. Plant J. 11: 1359-1368 |
41. | Sato, M., K. Sato, and A. Nakano. 1996. Endoplasmic reticulum localization of Sec12p is achieved by two mechanism: Rer1p-dependent retrieval that requires the transmembrane domain and Rer1p-independent retention that involves the cytoplasmic domain. J. Cell Biol. 134: 279-293 [Abstract]. |
42. |
Schroeder, M.R.,
O.N. Borkhsenious,
K. Matsuka,
K. Nakamura, and
N.V. Raikhel.
1993.
Colocalization of barley lectin and sporamin in vacuoles of
transgenic tobacco plants.
Plant Physiol.
101:
451-458
|
43. | Shimada, T., M. Kuroyanagi, M. Nishimura, and I. Hara-Nishimura. 1997. A pumpkin 72-kDa membrane protein of precursor-accumulating vesicles has characteristics of a vacuolar sorting receptor. Plant Cell Physiol. 38: 1414-1420 |
44. | Tao, J., I. Ginsberg, N. Banerjee, Y. Koltin, W. Held, and J.A. Bruenn. 1990. The Ustilago maydis KP6 killer toxin: structure, expression in Saccharomyces cerevisiae and relationship to other cellular toxins. Mol. Cell. Biol. 10: 1373-1381 |