From the Department of Entomology, University of
Georgia, Athens, Georgia 30602, ¶ Departement Chirurgie, DL
36, UniversitätsSpital Zürich, 8091 Zürich,
Switzerland, and
Division of Immunology, City of Hope,
Duarte, California 91010
![]() |
ABSTRACT |
---|
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
---|
In the female mosquito, Aedes aegypti, neurohormones are released from the brain in response to a blood meal and stimulate the ovaries to secrete ecdysteroid hormones, which modulate yolk protein synthesis in the fat body. Neuropeptides with this bioactivity were isolated from head extracts, and partial sequences from these peptides when aligned gave a 31-residue sequence at the amino terminus. Oligonucleotide primers for this sequence were used to amplify with the polymerase chain reaction a genomic DNA product that hybridized to a clone from a head cDNA library. The cDNA encodes a 149-residue preprohormone that is processed into an 86-residue peptide, as indicated by the mass value obtained from the native peptide, with the expected amino-terminal sequence. After modification, the cDNA for the putative neurohormone was expressed in a bacterial system, and the purified peptide had high specific activity in bioassays, thus confirming that it is a steroidogenic gonadotropin, the first to be identified for invertebrates.
![]() |
INTRODUCTION |
---|
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
---|
Among vertebrates, the gonadotropic neurohormones, follicle-stimulating hormone and luteinizing hormone, regulate steroidogenesis during reproductive cycles; for invertebrates, the only characterized steroidogenic neurohormones are the prothoracicotropic hormones, which initiate molting in insect larvae (1). The first insect gonadotropin was discovered by Lea (2, 3), who described a neurohormone controlling reproduction in mosquitoes. For the yellow fever mosquito, Aedes aegypti (Diptera: Culicidae), each reproductive cycle in a female begins with the ingestion of a blood meal and ends with egg deposition. The blood meal, in turn, stimulates release of gonadotropic neurohormones from medial neurosecretory cells in the brain for up to 12 h post ingestion (2, 3). These neurohormones stimulate the ovaries to secrete ecdysteroids and thus are referred to as "ovary ecdysteroidogenic hormones" (OEHs)1 (4). The ecdysteroids modulate fat body secretion of yolk proteins (5, 6), which are stored selectively in the oocyte for embryonic development.
Despite many attempts to purify gonadotropins from mosquitoes (4, 7, 8), only their peptide nature and apparent heterogeneity (3,500-24,000-Da range) are known. This report describes the purification of OEH I from an extract of six million heads and its structural characterization by a combination of biochemical and molecular techniques. To verify the biological activity of the putative neurohormone, a recombinant OEH I was expressed and purified for testing in vivo and in vitro, and with an OEH I antiserum, the source of the neurohormone was identified.
![]() |
EXPERIMENTAL PROCEDURES |
---|
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
---|
Bioassays-- To test chromatographic fractions and bacterial-expressed protein for bioactivity, samples (0.5 µl of saline solution/female) were injected into 3-5-day-old, sugar-fed females (nonoogenic), decapitated within 1 h after a blood meal. After 16-24 h at 30 °C, ovaries were dissected from the females to measure yolk deposition in oocytes. Bioactive peptides induced >100 µm of yolk deposition, and no yolk was evident in females treated as controls.
Samples with in vivo activity were tested for ecdysteroidogenesis by incubation with ovaries from nonoogenic females (four or five ovary pairs in 60 µl of saline solution, three replicates/dose). After 6 h at 30 °C, incubation media (50 µl) were assayed for ecdysteroid content by radioimmunoassay (4), using an antiserum characterized by Kingan (9). Typically, bioactive peptides stimulated secretion of ecdysteroids 2-3-fold over that of controls, and where indicated in the text (*), ecdysteroidogenesis stimulated by expressed OEH I was significantly greater than that of controls (Student's t test, p < 0.05).Preparation and Extraction of Mosquito Heads-- Heads from sugar-fed females, 5-7 days post eclosion (most males had died by this time), were separated from bodies (4) and extracted in batches of one million heads (50 g), for a total of six million heads. Each batch of heads was homogenized three times in 200 ml of ice-cold 0.2 M acetic acid solution with phenylmethylsulfonyl fluoride (40 mg/liter), EDTA (128 mg/liter), and thiodiglycol (0.1% v/v), after which the solution was sonicated and centrifuged. The supernatant solutions were pooled, partially lyophilized, rehydrated with 100 ml of 0.02 M ammonium acetate buffer (pH 4.5, containing 0.1% thiodiglycol), and centrifuged. The resultant supernatant solution was stripped of lipids by hexane partitioning prior to chromatography.
Purification of Native OEHs-- Prior to the extraction and purification of the OEH described in this report, bioactive peptides had been isolated from extracts of one or two million heads, as described below. An amino-terminal sequence from one of these peptides (PTNVLEIRWKLYSGPAVQNTGE-V) and two partial sequences from others digested with trypsin (- - -LPAVQNT-E-V- - - -LN and FVGDK-GESTAGIIMSGK-ASGLM) were obtained by M.R.B. at the Molecular Genetics Instrumentation Facility (University of Georgia).
Each extract of one million heads was fractionated first with cation exchange chromatography (CM-Sepharose CL-6B (Pharmacia Biotech Inc.), 30 × 2.6 cm inside diameter column; gradient of 0.02-0.5 M ammonium acetate buffer with 0.1% thiodiglycol; 30-40 ml/h, 6-8 ml/fraction; 280 nm). Bioactive fractions were divided into two groups, and each was subjected to ultrafiltration (10 kDa filter/150 ml Omegacell, Filtron Corp.; 40-55 p.s.i.). Afterward the bioactive retentate solutions (>10 kDa) were recombined for two semipreparative HPLC steps (Alltech, Macrosphere C18 column, 7 µm, 300 Å, 1 cm × 35 cm) and eluted with a gradient of solvent B: 20-100% over 90 min (2 ml/min/fraction, 280 nm). In the first step, solvent B was 60% 1-propanol, 20% CH3CN, 20% water, 0.1% heptafluorobutyric acid (HFBA; solvent A, water with 0.1% HFBA) and, in the second step, 0.01 M triethylammonium acetate (pH 5) was substituted for HFBA in the solvents. After the second step, bioactive fractions from all six batches were divided into three groups: A, fractions eluting in the earliest time range; B, the intermediate time range; and C, the latest time range. For the next chromatography step, each group of fractions was subdivided into three portions, and each portion fractionated with cation-exchange HPLC (Bio-Rad TSK SP-5PW, 75 × 7.5-mm inside diameter) using a gradient of 0.02-0.5 M ammonium acetate buffer (pH 4.5), 10% 1-propanol over 50 min (0.8 ml/min/fraction; 280 nm). Bioactive fractions obtained from the previous HPLC step for each group were divided into early and late eluting portions and separately fractionated with reversed-phase HPLC on a C8 column (Alltech Macrosphere, 5 µm, 300 Å, 250 × 4.6-mm inside diameter) with a gradient of solvent B (30% CH3CN, 30% 1-propanol, 40% water, 0.1% HFBA; solvent A, water with 0.1% HFBA): 20-30% for 5 min, 30-60% for 60 min, and 60-100% for 20 min (1 ml/min/fraction, 206 nm). Material from the A group of fractions was not purified further because the bioactivity was lost. For groups B and C, bioactive fractions eluting early (B.1 and C.1) and late (B.2 and C.2) in the last HPLC step were combined and separately fractionated with the same column and conditions as above, substituting 0.1% trifluoroacetic acid for HFBA. Bioactive fractions from the chromatography of the early and late fractions step were combined for another fractionation on the same column but with a different gradient of solvent B: 20-30% for 5 min, 30-50% for 60 min, and 50-100% for 15 min (peaks were manually collected). Bioactive material eluted with this step was resolved further by narrow bore HPLC (two Brownlee Aquapore C8 columns in series; 300 Å, 250 × 2.1-mm inside diameter) with a gradient of solvent B (60% CH3CN, 20% 1-propanol, 20% water, 0.1% trifluoroacetic acid; solvent A, water with 0.1% trifluoroacetic acid): 20-60% over 60 min (200 µl/min; peaks were manually collected; 214 nm). The bioactive material eluted as two peaks, the first and major peak was subjected to another purification step, and the second minor peak was not purified further. For the last step, the material from the first peak was eluted from a microcapillary HPLC system (Fig. 1A) (10, 11) using a C18 column (Vydac C18 matrix, 300 Å, 3 µm; 0.53-mm inside diameter × 250 mm) with a gradient of solvent B (90% CH3CN, 10% water, 0.07% trifluoroacetic acid; solvent A, water with 0.1% trifluoroacetic acid): 20-60% over 60 min (20 µl/min; peaks were collected manually; 214 nm). The bioactive material eluted as a single peak and was used for mass spectrometry and sequencing in the laboratory of K. M. Swiderek.Sequence Analyses-- For in situ reduction and alkylation of the peptide prior to endoproteolytic digests, 22.5 µl of 45 mM dithiothreitol were added to the peptide aliquot (~5 µl), and after a 15-min incubation at 50 °C, 2.5 µl of 100 mM iodoacetic acid were added for an additional 15-min incubation at room temperature, pH 8.0. Aliquots of the peptide were digested with trypsin (1:25 w/w, enzyme; peptide in 70 µl of water) or Asp-N endoproteinase (1:20 w/w in 150 µl of water). Peptide fragments were separated on the microcapillary HPLC system described above with a gradient of solvent B: 2-70% over 60 min and subjected to automated Edman degradation, with identification of the phenylthiohydantoin amino acid derivatives (12, 13).
Liquid Chromatography-Mass Spectrometry-- The peptide sample (5-20 pmol) was eluted from the microcapillary HPLC system (Vydac C18, 250-µm inside diameter × 200 mm) with a gradient of solvent B (as above): 2-92% over 45 min (2 µl/min; monitored at 200 nm). Mass spectra were recorded in the positive ion mode using a TSQ-700 triple quadrupole instrument (Finnigan-MAT, San Jose, CA) equipped with an electrospray ion source operating at atmospheric pressure (10). The electrospray needle was operated at a voltage differential of 3-4 kV with a sheath flow of 2 µl/min of 2-methoxyethanol. Spectra were collected continuously, and the scan time was 3 s/spectrum. Averaged spectra containing the peak were generated from scans collected over the peak, and masses were calculated using data reduction software (Finnigan MAT BIOMASS).
Preparation of Genomic DNA--
Genomic DNA was prepared from
frozen mosquitoes (2 g) ground in liquid nitrogen. The powder was mixed
with 9.0 ml of a 30 mM Tris/HCl buffer (pH 8) containing
100 mM NaCl, 10 mM EDTA, 10 mM
2-mercaptoethanol, and 0.5% Triton X-100. After clarification and
centrifugation, the pellet was incubated at 37 °C overnight in 1.0 ml of the same solution (without Triton X-100); 5.0 ml of a 100 mM Tris/HCl (pH 8) buffer containing EDTA (100 mM), proteinase K (0.5 mg/ml), NaCl (100 mM);
and 0.6 ml of 10% N-lauroylsarcosine. After centrifugation,
1.25 g of CsCl were added per g of supernatant solution, and the
mixture was centrifuged at 40,000 rpm, 20 °C for ~60 h. The DNA
was collected, dialyzed, and stored at 20 °C.
Polymerase Chain Reaction-- The oligonucleotide primers, 5'-AT GGATCC CCI ACI AAC/T GTI C/TTI GAA/G ATI A/CG-3' (sense strand for residues 2-9 of the peptide amino terminus with a BamHI site, underlined) and ATAAGC TTG GA/GT TIA A/GC/TT CIG CIC CA/GT GIA C (antisense strand for residues 25-31 with a HindIII site, underlined), were diluted to 1 µM in 10 mM Tris/HCl buffer (pH 8.4; 50 mM KCl, 2.5 mM MgCl2) with 200 µM of each deoxyribonucleotide, mosquito genomic DNA (100 ng), and AmpliTaq DNA polymerase (Perkin Elmer, 1 unit in 50-µl total volume) for amplification by PCR (35 cycles; 93 °C, 45 s; 61 °C, 2 min; 72 °C, 2 min). Products of the expected size were eluted from agarose gels, digested with the restriction enzymes, and ethanol-precipitated for ligation (T4 DNA ligase, Stratagene) into pBluescriptII SK(+) plasmids (Stratagene). XL1-Blue cells (Stratagene) were transformed with the ligation mixture and grown under ampicillin selection. Plasmids were purified from the cells using the alkaline lysis method (14). A primer, annealing upstream of the 5'-insertion site, was used to sequence the inserts; one insert sequence when translated matched the composite amino-terminal sequence of the bioactive peptides.
Mosquito Head cDNA Library and cDNA Cloning--
A
recombinant cDNA library was constructed from head mRNA, as
described by Graf et al. (15), and spread at 20,000 plaque-forming units per 150-mm plate. After overnight growth, lysis,
and reequilibration, DNA was transferred to nitrocellulose membranes
and baked for 2 h at 80 °C. The OEH 108-base pair PCR product
was cut from the pBluescript plasmid and labeled with
[-32P]dATP by Klenow polymerase for probing. Washing,
prehybridization, and hybridization conditions of Graf et
al. (15) were used to select and plaque purify a positive clone.
Two external plasmid primers and two internal primers were used to read
the sequence in both directions to verify the cDNA sequence.
Expression of OEH I cDNA in Escherichia coli and Purification
of the Expressed Peptide--
OEH I cDNA was modified for
insertion into a plasmid vector by PCR mutagenesis with methods
described above (95 °C, 45 s; 50 °C, 1 min; and 72 °C; 40 cycles). The oligonucleotides,
5'-GCATCGCATATGCCCACCAACGTCCTGGAGA-3' and
5'-CGTACGCTCGAGCTAACGCGGAGGGCACAACCGG-3', were used
as the forward and reverse primers, respectively. The forward primer added a NdeI restriction site (underlined) and ATG start
codon to the 5' end of the codon for the Pro at residue 24 (see Fig. 2). The reverse primer added a stop codon and a XhoI
restriction site (underlined) at the 3' end after the codon for the Arg
at residue 108. The PCR product was ligated into a pCR2 plasmid with a
TA cloning kit (Invitrogen), and the insert sequence verified. The PCR
product then was subcloned after it was cut free with NdeI
and XhoI and inserted into a pET17b vector (Novagen). A
nonexpression strain of E. coli (INVF', Invitrogen) was
transformed with the insert and pET17b vector. After amplification, the
plasmid DNA was isolated and used to transform an expression strain of
E. coli (BL21DE3).
Electrophoresis and Western blotting-- The expressed protein was solubilized (0.5 M Tris/HCl buffer (pH 6.8) with 12% glycerol, 1% SDS, and 2% 2-mercaptoethanol; boiled for 10 min), separated in 16.5% Tris-Tricine gels (Bio-Rad) at 100 V in 0.1 M Tris, 0.1 M Tricine buffer (pH 8.25) with 0.1% SDS, and stained with Coomassie Blue R-250. Polypeptide standards (Bio-Rad) were used to estimate the molecular weights of samples.
After electrophoresis, peptides from unstained gels were transferred onto polyvineylidene difluoride membranes (Bio-Rad, 0.2 µm; 100V at 4 °C in a 25 mM Tris, 192 mM glycine buffer, 20% methanol). The membranes were dried, washed in a mixture of 50% methanol and 20 mM Tris buffer (pH 7.5) containing 150 mM NaCl (TBS) and 0.05% Tween-20 (TBS-T), blocked for 1 h in TBS-T with 5% non-fat dry milk, and washed three times in TBS-T. After incubation at room temperature for 1 h with the OEH I antiserum (see "Immunocytochemistry," 1:4000 in TBS-T), the membranes were washed in TBS-T and incubated with anti-rabbit IgG antibodies conjugated to peroxidase (Sigma, 1:4000 in TBS-T) for 1 h at room temperature. Following washes in TBS-T and another wash in TBS, membranes were immersed in a staining solution (3',3'-diaminobenzidine tetrahydrochloride (Sigma), 10 mg in 10 ml of TBS with 1.0 mg of NiCl2 and 0.08% H2O2).Amino Acid Composition-- Prior to analysis, the partially purified OEH I from the bacterial expression was dried in a 6 × 50-mm glass tube. The sample was hydrolyzed with 6 N HCl at 110 °C for 24 h. Analysis was accomplished by separating amino acids with HPLC and by postcolumn derivatization with ninhydrin on a Beckman 6300 high performance analyzer running a low pH sodium citrate gradient (Na-A, B, D) according to the manufacturer's instructions.
Immunocytochemistry-- The amino acid sequence of the genomic DNA/PCR product (PTNVLEMRCKLYSGPAVQNTGECVHGAELN) was synthesized, conjugated to thyroglobulin with glutaraldehyde, and used as an antigen in rabbits. Two weeks after each immunization, sera were prepared, and one (34C) was used for immunocytochemistry on tissue sections of plastic-embedded mosquitoes, as described previously (16). After treatment with the antiserum (1/500 or 1/1000 dilution, 12-24 h, 4 °C), sections were treated sequentially with biotinylated goat antirabbit IgG and avidin-biotin-conjugated peroxidase (Vectastain Elite ABC kit, Vector Laboratories), and then stained (Hanker Yates dye, Polysciences). For negative controls, adjacent sections were treated with preimmune serum or antiserum preabsorbed with the antigenic synthetic peptide (5-10 µg/ml of diluted antisera, 24 h, 4 °C).
![]() |
RESULTS |
---|
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
---|
From the extraction of six million mosquito heads, three bioactive peptides were separated in the first few chromatographic steps. Only one of the peptides was isolated in sufficient quantity with a final step of microcapillary HPLC (Fig. 1A) to allow structural characterization. A portion of the peptide sample was subjected to mass spectrometry. Two predominant peaks, Mr-8803 and 8821 (the oxidation of a Met may account for the higher value), were evident along with a smaller peak, Mr-8595 (Fig. 1B). An attempt to sequence a portion of the peptide from the amino-terminus failed, so other portions were digested with trypsin or endoproteinase Asp-N. Sequences from a tryptic fragment (LYSGPAVQNTGE-VHGAELNP) and from Asp-N digest fragments (GVLYVLPAVQ and EIR- -LY-GPAVQN-G) were obtained. These sequences when aligned with ones obtained from the amino terminus (PTNVLEIRWKLYSGPAVQNTGE-V) and a tryptic fragment (- - -LPAVQNT-E-V- - - -LN) of bioactive peptides isolated from other head extracts gave a common sequence of 31 residues (PTNVLEIRG/WK/VLYS/VG/LPAVQNTGE-VHGAELNP) with alternative residues at four positions.
|
To complete the OEH sequence, oligonucleotides for the amino and carboxyl termini of the 31-residue sequence were used as primers to amplify by PCR a genomic DNA product. The translated sequence of the product (PTNVLEMRCKLYSGPAVQNTGECVHGAELN) resolved residue ambiguities, especially where a Cys was encoded, and differed from that of the peptide sequence at residues seven, Met for Ile, and nine, Cys for Gly/Trp. The PCR product then was used to probe a head cDNA library, and a clone was identified and sequenced. The cDNA clone is 973 nucleotides long and has an open reading frame encoding a 149-residue peptide that begins with a putative signal peptide followed by the PCR product sequence (Fig. 2). Residue 30 of the encoded peptide matches the corresponding residue seven, Ile, in the composite amino-terminal sequence of the bioactive peptide sequence and not the Met of the PCR product. Also, the sequence from residue 64 to 86 of the encoded peptide matches that of a tryptic fragment obtained from a bioactive peptide (FVGDK-GESTAGIIMSGK-ASGLM, see "Purification of Native OEHs," under "Experimental Procedures"). A search of protein data bases revealed that the encoded peptide sequence from residue 23 to 109 had the highest sequence similarity (29%) to that of a locust neurohormone, neuroparsin A (Fig. 3) (17). No other protein sequences were significantly similar, even when searches were limited to the sequence, KGVGDKCG (residue 62-68), that is seemingly conserved between OEH I and neuroparsin A.
|
|
A bacterial system was chosen for expression of the OEH I cDNA to determine whether the encoded peptide from residue 24-108 was bioactive. A peptide of ~9 kDa was the predominant form in a Western blot of solubilized protein from BL21/OEH I cells (Fig. 4); a dimer and trimer of the peptide also were evident. No immunoreactive peptides were evident in the protein from BL21/pET cells. Solubilized BL21/OEH I protein stimulated yolk deposition in all females injected over a range of 0.06 to 1.8 µg/female, whereas BL21/pET protein showed no bioactivity over the same range. Ovary ecdysteroidogenesis was stimulated approximately three fold with 1.0 µg of the BL21/OEH I protein (306 ± 47 pg* (X ± S.E.) ecdysteroids/50 µl of incubation media) above that with the same amount of BL21/pET protein (83 ± 30 pg). Greater amounts of the BL21/OEH I protein stimulated a similar level of ecdysteroidogenesis (4.0 µg of protein, 394 ± 25 pg* ecdysteroids; 2.0 µg, 339 ± 22 pg*) above that of BL21/pET protein (4.0 µg, 132 ± 30 pg; 2.0 µg, 43 ± 10 pg).
|
The solubilized BL21/OEH I protein was purified further by semipreparative HPLC to determine its specific activity in the bioassays. In addition, mass spectrometry of a portion of the purified BL21/OEH I peptide revealed a predominant peak of Mr-8691. The amount of purified peptide was calculated from the results of the amino acid analysis. This analysis also indicated that the amino acid composition of the expressed peptide was similar to that of OEH I (15 of the 16 amino acids quantified were ± 1.0 mol % of the value known for OEH I, excluding Cys residues). For the in vivo bioassay, the minimum amount of peptide found to stimulate yolk deposition in more than half of the injected females was 0.15 ng (0.017 pmol)/female (11/13 females injected); 0.58 and 0.29 ng/female had the same effect. Bioactivity was evident at 0.07 ng/female (4/13 females injected) and not at lower amounts. Ovary ecdysteroidogenesis in vitro was stimulated 2-fold (87 ± 13 pg* ecdysteroids/50 µl of incubation medium) with 57 ng (6.6 pmol) of the purified peptide above that of ovaries incubated in medium alone (39 ± 10 pg). With greater quantities of peptide, ecdysteroid production increased 3-fold (114 ng of peptide, 120 ± 6 pg* of ecdysteroids; 228 ng, 115 ± 10 pg*) and decreased with a smaller quantity (29 ng, 58 ± 9 pg).
To identify the source of OEH I in the mosquito head, the antiserum specific for the genomic DNA PCR product was used for immunocytochemistry. Immunoreactivity was observed in two or three pairs of medial neurosecretory cells in the female brain (Fig. 5) and in their axons extending to the corpus cardiacum, a neurohemal organ associated with the aorta. Preabsorption of the antiserum with the synthetic peptide blocked immunoreactivity.
|
![]() |
DISCUSSION |
---|
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
---|
Neuropeptides with gonadotropic and ecdysteroidogenic bioactivity in female mosquitoes were isolated from different extracts of several million heads and subjected to sequencing either before or after enzyme digests. Of those partial sequences, all but one could be aligned within a 31-residue sequence at the amino-terminal region. With this sequence information and molecular techniques, the preprohormone sequence for the first OEH (designated as OEH I) identified in mosquitoes was determined from a cDNA sequence (Fig. 2). Partial peptide sequences for the amino-terminal region and for a tryptic fragment of bioactive peptides are found within the prohormone sequence. In addition, the original studies of Lea (2, 3) are supported by the immunocytochemical localization of OEH I in the medial neurosecretory cells of female mosquitoes.
Structural and molecular characterization, taken together, suggest a putative sequence for the native OEH I. The value obtained by mass spectrometry of a bioactive peptide, Mr-8803, is the same as that predicted for an 86 residue peptide extending from a pGlu at residue 23, a converted Gln, to the carboxyl terminus, an Arg at residue 108 (an endoproteinase site), assuming four internal disulfide bonds (Fig. 2). Based on sequencing results from native peptides, the amino terminus may either be the Pro at residue 24 or the Gln at residue 23. The sequence beginning with the Pro at residue 24 and extending to residue 108 would have an estimated mass of 8692, which is less than the mass spectrometry value, thus indicating that pGlu is the more likely amino terminus. Unsuccessful attempts to sequence the amino terminus of the peptide subjected to mass spectrometry and other peptides previously isolated (4) adds further support for a pGlu, which in this position prevents Edman sequencing. With 12 Cys residues in the peptide sequence, up to six internal disulfide bonds can be formed; only with additional studies will the specific Cys residues forming the bonds be identified. The above sequence has a predicted pI of 7.8, consistent with its basic nature observed during chromatography, and there are no glycosylation sites. The fate and role of the putative peptide spanning residues 109-149 that is part of the OEH I prohormone are unknown.
Bacterial expression of the OEH I cDNA sequence from residues 24 to 108, without the putative pGlu at the amino terminus, yielded a peptide that was recognized by the OEH I antiserum in a Western blot. The purified peptide had high specific activity in both the in vivo and in vitro bioassays, thus confirming that OEH I is an ecdysteroidogenic gonadotropin. Yolk deposition in a blood-fed decapitated female was stimulated by as little as 11 nM expressed OEH I (0.017 pmol/female with ~1.0 µl of hemolymph and 0.5 µl of carrier saline solution). A 10 times greater concentration of the expressed peptide (110 nM peptide; 6.6 pmol/60 µl of medium) was needed to stimulate ecdysteroidogenesis by isolated ovaries. The high specific bioactivity of the expressed peptide suggests that the pGlu amino terminus is not an absolute requirement for bioactivity and that the peptide is folded in the same way as the native peptide. The mass value of 8692 obtained for the expressed peptide is the same as that estimated for this sequence with four disulfide bonds.
The amino acid sequence of OEH I has limited similarity with that of neuroparsin A (Fig. 3), a neurohormone in locusts; both peptides have twelve Cys residues, eight of which are positioned similarly. Neuroparsin A (Mr-8754) was isolated from the corpora cardiaca of adult Locusta migratoria, based on its antidiuretic activity, and sequenced (17). It is synthesized in the medial neurosecretory cells of the brain and stored in the corpora cardiaca, where it is processed into several truncated forms at the amino terminus, including neuroparsin B, with 78 residues (Mr-8185). Additionally, a cDNA of 683 base pairs encoding neuroparsin A was cloned from an adult brain cDNA library. Neuroparsins are best characterized for their stimulation of fluid uptake in the rectum of locusts through the inositol phosphate cascade (18). It is not known whether neuroparsins are steroidogenic in locusts.
Heterogeneity of OEHs was observed in this purification effort and in other reports (4, 7, 8). The different bioactive peptides may be due to the processing of a larger peptide into truncated forms during secretion, as with neuroparsin A, to peptide degradation during extraction and purification, to multiple genes encoding related peptides, or to the existence of structurally unrelated but functionally similar neuropeptides. Preliminary results from Southern analysis indicates the existence of a single copy of the OEH I gene with at least four alleles represented in the population of mosquitoes in our laboratory. These polymorphisms may account for the sequence differences between the PCR product and the OEH I cDNA. An insulin-like neuropeptide also may have a role in ovary ecdysteroidogenesis in mosquitoes, as suggested by characterization of an insulin receptor-like protein in mosquito ovaries and stimulation of this process by vertebrate insulin (15). Neuropeptides with very different molecular weights are known to stimulate ecdysteroidogenesis by the prothoracic glands of several insect species (19-21). The ovary maturating parsin (Mr 6927) of locusts (22, 23) is the only other structurally characterized gonadotropin known for adult insects. It is secreted from neurosecretory cells and stimulates ovarian development and vitellogenesis over several days; a direct effect on ovarian ecdysteroidogenesis has not been reported.
With the recombinant OEH I, direct effects of this neurohormone on vitellogenesis in the female mosquito can be studied, since it has been shown that 20-hydroxyecdysone indirectly stimulates yolk protein synthesis by the fat body (24) and that "head factors" affect yolk protein uptake by oocytes (25). In addition, the structural characterization of OEH I provides clues for the identification of related peptides that may be evolutionarily conserved for regulation of gonad steroidogenesis in other insects and invertebrates.
![]() |
ACKNOWLEDGEMENTS |
---|
We thank Ira Goldman, Dena Watkins, Doug Butts, Lon Grassman, and Scott Simonek for rearing and separating heads from millions of mosquitoes. Dr. Tim Kingan donated the ecdysteroid antiserum. Dr. Genelle L. Grossman critically read the manuscript and helped with revisions, and Dr. Joe W. Crim helped define the biological activity of the peptide.
![]() |
FOOTNOTES |
---|
* This work was supported in part by National Institutes of Health Grants AI17927 (to A. O. L.) and AI33108 (to M. R. B.), the Protein Sequencing Core Facility at City of Hope Grant CA33572, and the Swiss National Science Foundation Grant 31-29874.90 (to R. G.).The costs of publication of this article were defrayed in part by the payment of page charges. The article must therefore be hereby marked "advertisement" in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.
§ To whom all correspondence should be addressed: Dept. of Entomology, University of Georgia, Athens, GA 30602. Tel.: 706-542-2317; Fax: 706-542-2279; E-mail: mbrown{at}bugs.ent.uga.edu.
1 The abbreviations used are: OEH, ovary ecdysteroidogenic hormone; HFBA, heptafluorobutyric acid; HPLC, high performance liquid chromatography; PCR, polymerase chain reaction; Tricine, N-[2- hydroxy-1,1-bis(hydroxymethyl)ethyl]glycine.
![]() |
REFERENCES |
---|
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
---|