Metabotropic Glutamate Receptor Type 4 Is Involved in Autoinhibitory Cascade for Glucagon Secretion by {alpha}-Cells of Islet of Langerhans

Shunsuke Uehara, Akiko Muroyama, Noriko Echigo, Riyo Morimoto, Masato Otsuka, Shouki Yatsushiro, and Yoshinori Moriyama

From the Department of Biochemistry, Faculty of Pharmaceutical Sciences, Okayama University, Okayama, Japan


    ABSTRACT
 TOP
 ABSTRACT
 RESEARCH DESIGN AND METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 
In islets of Langerhans, L-glutamate is stored in glucagon-containing secretory granules of {alpha}-cells and cosecreted with glucagon under low-glucose conditions. The L-glutamate triggers secretion of {gamma}-aminobutyric acid (GABA) from ß-cells, which in turn inhibits glucagon secretion from {alpha}-cells through the GABAA receptor. In the present study, we tested the working hypothesis that L-glutamate functions as an autocrine/paracrine modulator and inhibits glucagon secretion through a glutamate receptor(s) on {alpha}-cells. The addition of L-glutamate at 1 mmol/l; (R,S)-phosphonophenylglycine (PPG) and (S)-3,4-dicarboxyphenylglycine (DCPG), specific agonists for class III metabotropic glutamate receptor (mGluR), at 100 µmol/l; and (1S,3R,4S)-1-aminocyclopentane-1,3,4-tricarboxylic acid (ACPT-I) at 50 µmol/l inhibited the low-glucose–evoked glucagon secretion by 87, 81, 73, and 87%, respectively. This inhibition was dose dependent and was blocked by (R,S)-cyclopropyl-4-phosphonophenylglycine (CPPG), a specific antagonist of class III mGluR. Agonists of other glutamate receptors, including kainate and quisqualate, had little effectiveness. RT-PCR and immunological analyses indicated that mGluR4, a class III mGluR, was expressed and localized with {alpha}- and F cells, whereas no evidence for expression of other mGluRs, including mGluR8, was obtained. L-Glutamate, PPG, and ACPT-I decreased the cAMP content in isolated islets, which was blocked by CPPG. Dibutylyl-cAMP, a nonhydrolyzable cAMP analog, caused the recovery of secretion of glucagon. Pertussis toxin, which uncouples adenylate cyclase and inhibitory G-protein, caused the recovery of both the cAMP content and secretion of glucagon. These results indicate that {alpha}- and F cells express functional mGluR4, and its stimulation inhibits secretion of glucagon through an inhibitory cAMP cascade. Thus, L-glutamate may directly interact with {alpha}-cells and inhibit glucagon secretion.

L-Glutamate, an excitatory neurotransmitter in the central nervous systems, plays important roles in fast synaptic transmission and neuronal plasticity (1,2). For glutamate-evoked neurotransmission, neuronal cells develop glutamatergic systems: exocytosis of L-glutamate, signal reception through various glutamate receptors, and signal termination through plasma membrane glutamate transporters. The islet of Langerhans, a pancreatic miniature endocrine organ for homeostasis of blood glucose, possesses glutamatergic systems similar to those in the central nervous system (3): L-glutamate is stored in glucagon-containing secretory granules through vesicular glutamate transporters, and it is cosecreted with glucagon from {alpha}-cells under low-glucose conditions (4,5). The released L-glutamate may bind to the glutamate receptor expressed on islet cells, resulting in the occurrence of the glutamatergic response of islet cells, although the glutamatergic response is not fully understood (3,612). Then, the glutamate signals may be terminated by sequestration of L-glutamate through Na+-dependent glutamate transporter (13).

In pioneering works, (RS)-{alpha}-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA)-type ionotropic glutamate receptors, mainly GluR2/3, were found to be expressed in {alpha}- and ß-cells (68), and their stimulation was reported to enhance the secretion of insulin under high-glucose conditions (6,7,14). AMPA and kainate, but not N-methyl-D-aspartate, were also shown to stimulate glucagon secretion from perfused pancreas (15). However, under low-glucose conditions, L-glutamate secreted from {alpha}-cells stimulates an AMPA-type receptor and selectively triggers {gamma}-aminobutyric acid (GABA) secretion, with a lower effect on insulin secretion in isolated islets and clonal ß-cells (4). Because GABA is stored in synaptic-like microvesicles, distinct secretory vesicles from insulin granules, in ß-cells (16), the glutamatergic response was explained as being caused by enhanced exocytosis of GABA-containing synaptic-like microvesicles (4). Because {alpha}-cells express the GABAA receptor, a chloride channel, and its stimulation modulates the membrane potential, causing inhibition of glucagon secretion (1719), glutamatergic signaling from {alpha}-cells and subsequent GABAergic signaling from ß-cells seem to be involved in the inhibition of glucagon secretion (3).

Recently, Tong et al. (11) reported that islet {alpha}-cells express metabotropic glutamate receptor type 8 (mGluR8), and that its stimulation by agonists (R,S)-phosphonophenylglycine (PPG) and (S)-3,4-dicarboxyphenylglycine (DCPG; at around the nmol/l level) strongly inhibits glucagon secretion under low-glucose conditions. This report is of special interest because if mGluR8 actually functions in islet {alpha}-cells, the mGluR-mediated signaling cascade should be another signaling pathway for the inhibition of glucagon secretion, which may support the involvement of L-glutamate signaling in the inhibition of glucagon secretion.

mGluRs belong to a big family of glutamate receptors and are classified into three distinct groups (classes I, II, and III) according to their sequence homology, second messenger coupling, and agonist selectivity (20). Class I receptors consist of mGluR1 and -5, which are linked to phosphatidylinositol hydrolysis/Ca2+ signal transmission. Class II receptors (mGluR2 and -3) and class III receptors (mGluR4, -6, -7, and -8) are coupled with inhibitory G-protein (Gi) protein, and thus their stimulation results in the inhibition of adenylate cyclase and a decreased cellular cAMP level. A pioneering group has reported negative results as to the expression of mGluRs in clonal ß-cells (21). However, Brice et al. (12) recently detected expression of the mGluR3, -4, -5, and -8 gene (using RT-PCR) and expression of the mGluR3 and 5 proteins (using immunoblotting) in isolated islets and clonal {alpha}- and ß-cells. Taking the observation of Tong et al. (11) into consideration, it is clear that there is no consensus as to the expression of mGluRs in islets. To further investigate the glutamatergic signaling cascade through mGluR, it is necessary to establish which type of mGluR is actually expressed in islet {alpha}-cells.

In the present study, we examined the expression of mGluRs by means of a combination of procedures, including pharmacological techniques, RT-PCR, immunoblotting, and immunohistochemistry with pancreas and purified islets of rat. Here we report the evidence for functional occurrence of mGluR4, but not other mGluRs (including mGluR8), in islets. mGluR4 is present in {alpha}-cells and F cells that secrete pancreatic polypeptide, and its stimulation inhibits the secretion of glucagon through an inhibitory cAMP cascade. The present results provide the molecular basis for the occurrence of an L-glutamate–mediated autoinhibitory mechanism for glucagon secretion by islet {alpha}-cells.


    RESEARCH DESIGN AND METHODS
 TOP
 ABSTRACT
 RESEARCH DESIGN AND METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 
Preparation.
Islets of Langerhans were isolated from male Wistar rats at 7–8 postnatal weeks by the collagenase digestion method combined with discontinuous Ficoll gradient centrifugation (22). Islets were then handpicked and suspended in a bicarbonate-buffered Hank’s solution supplemented with 0.2% BSA. In some experiments, islets (500 pieces) were washed with 20 mmol/l MOPS-Tris (pH. 7.0) containing 0.3 mol/l sucrose, 5 mmol/l EDTA, 5 µg/ml leupeptin, 5 µg/ml chymostatin, 5 µg/ml antipain, and 5 µg/ml pepstatin A and then extensively homogenized. The homogenate was centrifuged at 800g for 10 min, and the resultant supernatant was centrifuged at 140.000g for 1 h.

RT-PCR.
Total RNA extracted from isolated islets (1 µg) was transcribed into cDNA in a final volume of 20 µl of a reaction buffer containing 0.2 mmol/l each deoxynucleotide triphosphate (dNTP), 10 mmol/l dithiothreitol, 25 pmol of random octamers, and 200 units of Moloney murine leukemia virus reverse transcriptase (Amersham). After 1 h incubation at 42°C, the reaction was terminated by heating at 90°C for 5 min. For PCR amplification, the 10-fold–diluted synthesized cDNA solution was added to the reaction buffer containing 0.6 mmol/l total dNTP (150 µmol/l each dNTP), 25 pmol of primers (see Fig. 1A), and 1.5 units of Ampli Taq-Gold DNA polymerase (Perkin Elmer). A total of 35 temperature cycles were conducted, as follows: denaturation at 94°C for 30 s, annealing at a specific temperature shown in Fig. 1A for 30 s, and extension at 72°C for 1 min. The amplification products were analyzed by polyacrylamide gel electrophoresis. The sequences of the oligonucleotides used as primers were based on the published sequences of various mGluRs. DNA sequencing was performed by the chain-termination method (23).




View larger version (98K):
[in this window]
[in a new window]
 
FIG. 1. Expression of mGluRs genes in islets and exocrine pancreas. A: The probes used for RT-PCR analysis and the amplification conditions. B: Expression of various mGluR genes, as indicated, in brain (B), isolated islets (L), and exocrine pancreas (E) was examined by RT-PCR. No amplified products were obtained without the RT reaction (-RT). Tm, temperature.

 
Expression of mGluR4.
Rat mGluR4 cDNA, kindly provided by Dr. S. Nakanishi (24), was subcloned into the EcoRI-XhoI site of expression vector pcDNA3.1 (Invitrogen, San Diego, CA). The resultant construct was used to transfect COS7 cells by lipofection using Trans It reagent (Mirus, Madison, WI). COS7 cells were cultured in Dulbecco’s modified Eagle’s medium (DMEM) containing 10% FCS as described previously (25). Membrane fraction was prepared as described above.

Antibodies.
Site-specific rabbit polyclonal antibodies against rat mGluR4 were produced as follows: DNA fragments encoding MSGKGGWAWWWARLPLCLLLSLYAPWVPSSLGKPKGHPHMNS (24) were amplified by PCR and cloned into the EcoR1 site of expression vector pGEX3X (Amersham Pharmacia Biotech) to form glutathione S-transferase (GST) fusion plasmids. DNA fragments encoding the NH2-terminal region of mGluR8, MVCEGKRLASCPCFFLLTAKFYWILTMMQRTHSQEYAH (GenBank accession no. U63288) (26), were also amplified and cloned into pGEX3X as described above. After transformation, the GST fusion proteins were purified on a glutathione-Sepharose 4B column (Amersham Pharmacia Biotech) and then injected into a rabbit with complete adjuvant two times with a 2-week interval. The DNA fragments encoding the above-mentioned polypeptides of the NH2-terminal region of mGluR4 and -8 were also cloned into the XhoI and EcoRI site of expression vector pBAD/myc-His B (Invitrogen). After transformation of the resultant plasmids, the six His-tagged polypeptides were purified through a Ni-NTA column (Qiagen, Tokyo) according to the manufacturer’s manuals. The mouse monoclonal antibodies against glucagon were from Progen. The rat monoclonal antibodies against somatostatin, mGluR2/3, mGluR5, and mGluR8 were from Chemicon. The guinea pig polyclonal antibodies against insulin and rat pancreatic polypeptide were from Biogenesis and Linco Research, respectively. Alexa Fluor 568–labeled anti-mouse IgG and Alexa Fluor 488–labeled goat anti-rabbit IgG were from Molecular Probes.

Western blotting.
Membrane fraction was suspended in SDS sample buffer and then subjected to SDS gel electrophoresis. Immunoblotting was performed according to the published protocol, with visualization by enhanced chemiluminescence amplification (Amersham Pharmacia Biotech) (4).

Immunohistochemistry.
Indirect immunofluorescence microscopy was performed as described previously, using an Olympus FV-300 confocal laser microscope (25).

Assays.
Isolated islets (20 pieces per assay) or cultured cells (4.0 x 106 cells/dish) were washed three times with DMEM and then incubated in Ringer’s solution containing 10 mmol/l HEPES (pH 7.4), 0.2% BSA, and glucose at the specified concentration for 1 h at 37°C. Then, the islets or cultured cells were transferred to 2 ml of the above Ringer’s solution containing glucose at the specified concentration. At the times indicated, samples (10 µl) were taken, and the amount of glucagon and cAMP was quantified with enzyme immunosorbent assay kits obtained from Amersham Pharmacia Biotech and Yanaihara (Shizuoka, Japan) according to the manufacturers’ manuals. For measurement of cAMP, islets were extensively homogenized with 20 mmol/l MOPS-Tris (pH 7.0) containing 0.3 mol/l sucrose, 5 mmol/l EDTA, 5 µg/ml of leupeptin, 5 µg/ml of chymostatin, 5 µg/ml of antipain, and 5 µg/ml of pepstatin A and then centrifuged at 140.000g for 1 h. The resultant supernatant was used for assay.

Statistics.
Statistical significance between sets of data were assessed using Student’s t test.

Materials.
Agonists and antagonists for GluRs listed in Table 1 were purchased from Tocris Cookson (Avonmouth, U.K.). Other chemicals were of the highest grade commercially available.


View this table:
[in this window]
[in a new window]
 
TABLE 1 The effects of L-glutamate and agonists of GluRs on low-glucose-dependent glucagon secretion

 

    RESULTS
 TOP
 ABSTRACT
 RESEARCH DESIGN AND METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 
Pharmacological evidence for involvement of class III mGluR(s) in the inhibition of glucagon secretion.
As the first step of this study, we investigated whether mGluRs are involved in the regulation of glucagon secretion, using a pharmacological approach (Table 1). L-Glutamate at 1 mmol/l inhibited low-glucose–dependent glucagon secretion, as glucose secreted at 16.7 mmol/l subtracted from that secreted at 3.3 mmol/l glucose, by 87%. L-Glutamate at 100 µmol/l was inhibitory, with 55% less effectiveness than that at 1 mmol/l. L-Glutamate is also inhibitory to the arginine-evoked secretion of glucagon: arginine at 15 mmol/l enhanced secretion of glucagon 2.3-fold at 3.3 mmol/l glucose, and arginine-enhanced secretion of glucagon was inhibited by 79% upon treatment of L-glutamate at 1 mmol/l. PPG and DCPG (agonists for class III mGluRs) (27) at 100 µmol/l also inhibited glucagon secretion by 81 and 73%, respectively. The inhibition was dose dependent: at 40 nmol/l both agonists were not effective, the effectiveness being 50% at 40 µmol/l. At >100 µmol/l, no further inhibition was observed. Moreover, it was found that (1S,3R,4S)-1-aminocyclopentane-1,3,4-tricarboxylic acid (ACPT-I; another agonist for class III mGluR) (28) at 50 µmol/l inhibited glucagon secretion by 87%. The L-glutamate–, PPG-, DCPG-, and ACPT-I–evoked inhibition of glucagon secretion was blocked by (R,S)-cyclopropyl-4-phosphonophenylglycine (CPPG), an antagonist for class III mGluRs (29), at 100 µmol/l. Essentially the same glucagon secretion was observed when CPPG itself was included in the assay mixture. (2S,1'S,2'S)-2-(2-carboxycyclopropyl)-2-(9H-xanthen-9-yl)glycine (LY341495) is an antagonist with a Ki value of 57 nmol/l for mGluR8, which is a ~1,000-fold higher affinity than that for mGluR4 (30). The compound moderately blocked the L-glutamate–evoked inhibition of glucagon secretion at 30 µmol/l, but it did not block inhibition at all at 300 nmol/l. (S)-3,5-dihydroxyphenylglycine [(S)-3,5-DHPG] and quisqualate (specific agonists for class I mGluR) (31,32) at 1 mmol/l or (2S,3S,4S)-2(carboxycyclopropyl)glycine (L-CCG-I) at 100 µmol/l and (±)-1-aminocyclopentane-trans-1,3-dicarboxylic acid (trans-ACPD) at 1 mmol/l (agonists for class II mGluRs) (20,33,34) were only slightly effective (Table 1). AMPA and kainate (agonists for ionotropic glutamate receptors) at 0.5 mmol/l also slightly affected glucagon secretion (Table 1). These results suggest that class III mGluRs, most probably mGluR4, are involved in the inhibition of glucagon secretion.

Expression and localization of mGluR4 in islets.
Subsequently, we examined which types of mGluRs are expressed in islets. Among the known mGluRs examined, RT-PCR analysis indicated the amplification of RNA fragments of mGluR4 (Fig. 1). The amplified products covered all predicted sequences. The sequence of the amplified RNA fragment was identical to the corresponding sequence of mGluR4. On the other hand, no amplification of RNA fragments for other mGluRs was observed, although the same probes could amplify the predicted gene fragments from brain sources (Fig. 1). In particular, three different sets of primers for mGluR8 did not give any positive products for islet RNA, although these primers gave amplified products with the expected sizes and sequences for brain RNA (Fig. 1). Essentially the same results were obtained with the various amplification protocols used with an annealing temperature of 60 or 65°C (data not shown). These results led us to conclude that the mGluR4 gene is actually expressed in the islets, but expression of the genes of other mGluRs is negative or under the detection limit of our assay.

Similar RT-PCR analyses were performed using RNA prepared from exocrine pancreas. Fragments of mGluR3 and -5 with the expected sizes and sequences were amplified, whereas no amplification of the mGluR4 gene was observed (Fig. 1). Thus, in contrast with isolated islets, the exocrine part of pancreas shows different expression of mGluRs.

To detect the expression of mGluR4 at the protein level, we prepared site-specific antibodies against mGluR4. The mGluR4 antibodies recognized a 100-kDa polypeptide of authentic mGluR4 expressed in COS7 cells (Fig. 2A, left panel). The immunoreactivity disappeared when antigenic polypeptides (1 mg) were included during the immunoreaction. Dot blot analysis indicated that the mGluR4 antibodies recognized the NH2-terminal region of mGluR4, but they did not recognize the counterpart of mGluR8 (Fig. 2A, right panel). These results gave credence to the immunological specificity of the mGluR4 antibodies used in the study. The mGluR4 antibodies recognized a single 100-kDa polypeptide in islet membranes as well as brain membrane (Fig. 2B). The immunoreactivity disappeared when antigenic polypeptides (1 mg) were included during the immunoreaction. These results demonstrated the presence of the mGluR4 protein in islets. Double-labeling indirect immunofluorescence microscopy revealed that mGluR4 immunoreactivity is confined to islets but not to exocrine parts of pancreas (Fig. 2C). mGluR4 immunoreactivity is colocalized with glucagon and with pancreatic polypeptide but not with insulin or somatostatin (Fig. 2C). Treatment with antigenic peptides caused the mGluR4 immunoreactivity to disappear (data not shown). These results indicate that mGluR4 is present in {alpha}- and F cells but not in ß- and {delta}-cells.




View larger version (127K):
[in this window]
[in a new window]
 
FIG. 2. Expression and localization of mGluR4 protein in islets. A: Left panel: The immunological specificity of mGluR4 antibodies was proven with mGluR4-expressing COS7 cells. Membrane fractions of control COS cells (lane 1) and mGluR4-expressing COS7 cells (100 µg each) (lanes 2 and 3) were solubilized and subjected to SDS-PAGE, followed by immunoblotting with anti-mGluR4 antibodies (lanes 1 and 2) or the same antibodies plus 1 mg antigenic peptide (lane 3). Right panel: Dot blot analysis. Polypeptides of His-tagged NH2-terminal region of mGluR4 (lane 1) and mGluR8 (lane 2) at 2 µg each were spotted onto nitrocellulose sheets. One portion was stained with Amidoschwartz 10B (Merck). Other portions were decorated with antibodies against mGluR4 or mGluR8, as indicated, and the immunological reaction was visualized with enhanced chemiluminescence. B: Western blotting of brain membrane fraction (50 µg) (lanes 1 and 3) and islets (100 µg) (lanes 2 and 4) was performed with mGluR4 antibodies (lanes 1 and 2) or the same antibodies plus 1 mg antigenic peptide (lanes 3 and 4). C: Immunohistochemical localization of mGluR4 in islets. Sections of pancreas were doubly immunostained with antibodies against mGluR4 and glucagon, mGluR4 and insulin, mGluR4 and somatostatin, or mGluR4 and pancreatic polypeptide, and then they were observed under a confocal laser microscope. Bar = 10 µm.

 
Consistent with the absence of mRNA of other mGluRs in islets, neither antibodies against mGluR2/3 nor those against mGluR5 recognized any polypeptides of islets on immunoblotting, whereas these antibodies recognized counterparts of brain membranes (Fig. 3A). Consistently, anti-mGluR2/3 and -mGluR5 antibodies did not immunostain any islet cells, but they immunostained synaptic terminals and blood vessels in pancreas as well as brain sections (Fig. 3B). As for mGluR8, mGluR8 antibodies did not recognize any polypeptides of islets on immunoblotting (Fig. 3A). After immunohistochemistry, mGluR8 antibodies slightly immunostained islet cells (Fig. 3B), although the immunoreactivity did not disappear even in the presence of antigenic peptides (data not shown). These results indicated that the level of mGluR2/3, mGluR5, or mGluR8 in islets is, if anything, very low or under the detection limit of our assay.



View larger version (78K):
[in this window]
[in a new window]
 
FIG. 3. mGluR2/3, mGluR5, and mGluR8 were not detected in islets. A: Western blotting of brain membrane fraction (50 µg) (lane 1) and islets (100 µg) (lane 2) was performed with the listed antibodies. B: Sections of cerebrum (left panels) and pancreas (right panels) were immunostained with antibodies against mGluR2/3, mGluR5, and mGluR8 and then observed under a fluorescence microscope. Right panels: An islet is located at the center position. Immunoreactive blood vessels (middle right panel) and parts of nerve terminal of innervated neurons (bottom right panel) were marked. Bar = 10 µm.

 
Intracellular signaling pathway for the inhibition of glucagon secretion.
Because mGluR4 is a class III mGluR, its stimulation may inhibit adenylate cyclase through activation of Gi protein, followed by a decrease in a cAMP level, resulting in the inhibition of glucagon secretion. To obtain convincing evidence for functional coupling between mGluR4 and adenylate cyclase, the effects of dibutyryl cAMP (DBcAMP; a nonhydrolyzable cAMP analog) and pertussis toxin (PTX; a specific uncoupler of adenylate cyclase and Gi) were investigated. DBcAMP treatment abolished the glutamate- and PPG- or ACPT-I–evoked decreases in glucagon secretion (Fig. 4). PTX also blocked the glutamate- and PPG- or ACPT-I–dependent decreases in glucagon secretion and cAMP content (Figs. 4 and 5). Because it is known that islet {alpha}-cells contain PTX-sensitive Gi protein (35,36), these results strongly suggest that mGluR4 and adenylate cyclase are functionally coupled through Gi in {alpha}-cells.



View larger version (32K):
[in this window]
[in a new window]
 
FIG. 4. The effects of PTX and DB-cAMP on the L-glutamate–, PPG-, or ACPT-I–evoked inhibition of glucagon secretion. Isolated islets (20 pieces per assay) were incubated, and glucagon secretion was assayed as described in the legend to Table 1 in the presence of the listed compounds. The additions were made as follows: 100 ng/ml PTX, 1 mmol/l L-glutamate, 100 µmol/l PPG, 50 µmol/l ACTP-I, and 1 mmol/l DBcAMP. In the case of PTX treatment, islets were incubated with PTX for 21 h as described in (38), washed, and then treated with the listed compounds. After incubation for 30 min, the glucagon content in the medium was measured. Data are means ± SE (n = 4). #P < 0.001 when compared with the value of control (no addition); *P < 0.01; **P < 0.001.

 


View larger version (28K):
[in this window]
[in a new window]
 
FIG. 5. The effects of PTX and CPPG on the L-glutamate–, PPG-, or ACPT-I–evoked change of the cAMP content. Isolated islets (20 pieces per assay) were incubated as described in the legend for Fig. 4 in the presence or absence of the listed compounds, and the cAMP content in islets was measured. The additions were made as follows: 100 ng/ml PTX, 100 µmol/l CPPG, 1 mmol/l L-glutamate, 100 µmol/l PPG, and 50 µmol/l ACTP-I. Data are means ± SE (n = 4). #P < 0.001 when compared with the value of control (no addition); *P < 0.01; **P < 0.001.

 

    DISCUSSION
 TOP
 ABSTRACT
 RESEARCH DESIGN AND METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 
In this study, we showed that L-glutamate inhibits glucagon secretion from isolated islets under low-glucose conditions. AMPA and kainate did not stimulate glucagon secretion under low-glucose conditions. These results support our proposal that glutamatergic signaling is involved in the inhibition of glucagon secretion (3,4). Furthermore, L-glutamate–evoked inhibition of glucagon secretion was blocked on treatment with CPPG, indicating possible involvement of class III mGluR in this inhibitory process. We then investigated which mGluR is responsible for the inhibition. We found that mGluR4 is the major mGluR in the islet of Langerhans, and it is involved in L-glutamate–evoked inhibition of glucagon secretion. Four lines of evidence support this conclusion. At first, pharmacological analysis suggested the functional involvement of class III mGluRs in the inhibition of low-glucose–stimulated glucagon secretion. Second, RT-PCR analysis demonstrated the presence of mRNA of mGluR4. Third, we prepared antibodies specific to mGluR4 and demonstrated the presence of the mGluR4 polypeptide in islets. Finally, immunohistochemical analysis indicated that mGluR4 is present in {alpha}- and F cells but not {delta}- and ß-cells, supporting the results of our pharmacological analysis.

Our results are partly consistent with previous observations reported by two groups (6,21): no expression of mGluRs was detected in ß-cells and clonal ß-cells. Brice et al. (12) also detected amplification of a gene fragment of mGluR4 after RT-PCR, although they did not perform immunological identification. They also reported amplification of mRNA fragments of other mGluRs (mGluR3, -5, and -8), although no expression of these mGluRs was observed in our case. At present, we do not know the reason for the apparent discrepancy. It should be stressed, however, that the mGluR3 and -5 genes are expressed in the exocrine parts of pancreas (Figs. 1 and 3). Thus, the presence of acinar cells in an islet preparation may be expected to lead to amplification of the gene fragments of these mGluRs.

More importantly, we could not confirm the expression and localization of mGluR8 in islet {alpha}-cells. Even with the same DNA probes for RT-PCR analysis (Fig. 1A) (11), we could not detect any expression of the mGluR8 gene. Although the mGluR8 antibodies slightly immunostained islets, as judged by fluorescent microscopy, the immunoreactivity was observed throughout the islets, especially in ß-cells (Fig. 3), and did not disappear when excess amounts of antigenic peptides were included during immunoreaction. Consistent with these observations, Western analysis with mGluR8 antibodies did not reveal any polypeptide from isolated islets (Fig. 3). These results strongly suggest that immunoreaction by mGluR8 antibodies is artificial in nature, and the concentration of mGluR8 protein in {alpha}-cells is under the detection limit or very low as compared with that of mGluR4.

In addition, Tong et al. (11) reported that DCPG and PPG at 20 and 40 nmol/l had the maximum inhibitory effect on glucagon secretion. The values are actually too low compared with the above-mentioned abilities of authentic mGluR8 or even authentic mGluR4 of rat (27,28), and they are far from the concentrations required for the inhibition of glucagon secretion (Table 1). We showed that the concentrations giving 50% effectiveness of DCPG and PPG were ~28 and ~19 µmol/l, respectively, which are around the Kd value of CPPG with respect to recombinant mGluR4 expressed in cultured cells or rat tissues (37). ACPT-I most potently inhibited glucagon secretion (Table 1). Moreover, LY341495 did not affect the L-glutamate–evoked inhibition of glucagon secretion at 300 nmol/l, a several-fold higher concentration of Ki value for mGluR8 (30). These results further support the involvement of mGluR4 but not mGluR8 in the inhibition of glucagon secretion. Thus, the observation of Tong et al. (11) is incorrect.

Stimulation of mGluR4 causes inhibition of glucagon secretion. mGluR4 is a class III mGluR and is thus believed to be negatively coupled with adenylate cyclase. As expected, the addition of L-glutamate, PPG, or ACPT-I decreased the cellular cAMP level, which was inhibited by CPPG and PTX (Fig. 5). The involvement of DBcAMP also led to the recovery of the PPG-evoked inhibition of secretion of glucagon (Fig. 4). As for the cellular cAMP level, essentially the same responses to L-glutamate and CPPG were observed in {alpha}TC6 cells, which are clonal {alpha}-cells (S.U., Y.M., unpublished observation). CPPG resulted in enhanced glucagon secretion and cAMP content (Table 1, Fig. 5), suggesting that endogenous L-glutamate released from isolated islets tonically acts through an inhibitory cascade. Although PTX is expected to show the same effect as CPPG, the compound did not enhance either glucagon secretion or cAMP content (Figs. 4 and 5). The reason for the apparent ineffectiveness of PTX is unknown at present but seems to be caused by decreased viable cells during incubation over a long period. Overall, we concluded that signaling pathways from mGluR4 to Gi and adenylate cyclase operate in {alpha}-cells. In vivo, the following signaling cascade can be expected to operate: under low-glucose conditions, L-glutamate is secreted by {alpha}- or F cells. Then, the released L-glutamate may bind to the mGluR4 on {alpha}-cells so as to inhibit glucagon secretion through an inhibitory cAMP cascade. The mGluR4-mediated signaling pathway will provide the molecular basis for chemotherapeutics for hyperglycemia, one of the symptoms for type 2 diabetes.

In conclusion, islet {alpha}-cells express functional mGluR4 as a major mGluR. L-Glutamate itself may function as an autocrine transmitter and inhibit glucagon secretion by way of the mGluR4-mediated inhibitory cascade. The glutamatergic signaling also triggers GABA secretion from ß-cells, and the released GABA in turn inhibits glucagon secretion by way of the GABAA receptor. Thus, the L-glutamatergic system may inhibit glucagon secretion through two distinct signaling pathways, and it may constitute a novel regulatory mechanism of glucagon secretion in the islet of Langerhans.


    ACKNOWLEDGMENTS
 
This study was supported by a Grant-in-Aid for Scientific Research on Priority Areas–Advanced Brain Science Project from the Ministry of Education, Science, Sports and Culture of Japan, and the Umami Research Foundations. S.Y. was supported by a Research Fellowship from the Japan Society for the Promotion of Science for Young Scientists.

We thank Prof. S. Nakanishi (Kyoto University School of Medicine) for the kind supply of mGluR4 cDNA.


    FOOTNOTES
 
S.U. and A.M. contributed equally to the present study.

Address correspondence and reprint requests to Dr. Y. Moriyama, Department of Biochemistry, Faculty of Pharmaceutical Sciences, Okayama University, Okayama 700-8530, Japan. E-mail: moriyama{at}pheasant.pharm.okayama-u.ac.jp

Received for publication September 22, 2003 and accepted in revised form January 5, 2004

ACPT-I, (1S,3R,4S)-1-aminocyclopentane-1,3,4-tricarboxylic acid; AMPA, (RS)-{alpha}-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid; CPPG, (R,S)-cyclopropyl-4-phosphonophenylglycine; DBcAMP, dibutyryl cAMP; DCPG, (S)-3,4-dicarboxyphenylglycine; DMEM, Dulbecco’s modified Eagle’s medium; dNTP, deoxynucleotide triphosphate; GABA, {gamma}-aminobutyric acid; Gi, inhibitory G-protein; GST, glutathione S-transferase; L-CCG-I, (2S,3S,4S)-2(carboxycyclopropyl)glycine; LY341495, (2S,1'S,2'S)-2-(2-carboxycyclopropyl)-2-(9H-xanthen-9-yl)glycine; mGluR, metabotropic glutamate receptor; PPG, (R,S)-phosphonophenylglycine; PTX, pertussis toxin; (S)-3,5-DHPG, (S)-3,5-dihydroxyphenylglycine; trans-ACPD, (±)-1-aminocyclopentane-trans-1,3-dicarboxylic acid


    REFERENCES
 TOP
 ABSTRACT
 RESEARCH DESIGN AND METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 

  1. Fagg GE, Foster AC: Amino acid neurotransmitters and their pathways in the mammalian central nervous system. Neuroscience9 :701 –719,1983[Medline]
  2. Mayer ML, Westbrook GL: The physiology of excitatory amino acids in the vertebrate central nervous system. Prog Neurobiol28 :197 –276,1987[Medline]
  3. Moriyama Y, Hayashi M: Glutamate-mediated signaling in the islets of Langerhans: a thread entangled. Trends Pharmacol Sci24 :511 –517,2003[Medline]
  4. Hayashi M, Yamada H, Uehara S, Morimoto R, Muroyama A, Takeda J, Yamamoto A, Moriyama Y: Secretory-granule-mediated co-secretion of L-glutamate and glucagon triggers the glutamatergic chemical transmission in the islet of Langerhans. J Biol Chem278 :1966 –1974,2003[Abstract/Free Full Text]
  5. Yamada H, Otsuka M, Hayashi M, Nakatsuka S, Hamaguchi K, Yamamoto A, Moriyama Y: Ca2+-dependent exocytosis of L-glutamate by {alpha}TC6 cells, clonal mouse pancreatic {alpha}-cells. Diabetes50 :1012 –1020,2001[Abstract/Free Full Text]
  6. Gonoi T, Mizuno N, Inagaki N, Kuromi H, Seino Y, Miyazaki J, Seino S: Functional neuronal ionotropic glutamate receptors are expressed in the non-neuronal cell line MIN6. J Biol Chem269 :16989 –16992,1994[Abstract/Free Full Text]
  7. Inagaki N, Kuromi H, Gonoi T, Okamoto Y, Ishida H, Seino Y, Kaneko T, Iwanaga T, Seino S: Expression and role of ionotropic glutamate receptors in pancreatic islet cells. FASEB J9 :686 –691,1995[Abstract/Free Full Text]
  8. Weaver CD, Yao TL, Powers AC, Verdoorn TA: Differential expression of glutamate receptor subtypes in rat pancreatic islets. J Biol Chem271 :12977 –12984,1996[Abstract/Free Full Text]
  9. Molnar E, Varadi A, McIIhinney RAJ, Ashcroft SJH: Identification of functional ionotropic glutamate receptor proteins in pancreatic ß-cells and in islets of Langerhans. FEBS Lett371 :253 –257,1995[Medline]
  10. Morley P, MacLean S, Gendron TF, Small DL, Tremblay R, Durkin JP, Meaing G: Pharmacological and molecular characterization of glutamate receptors in the MIN6 pancreatic beta-cell line. Neurol Res22 :379 –385,2000[Medline]
  11. Tong Q, Ouedraogo R, Kirchgessner AL: Localization and function of group III metabotropic glutamate receptors in rat pancreatic islets. Am J Physiol Endocrinol Metab282 :E1324 –E1333,2002[Abstract/Free Full Text]
  12. Brice NJ, Varadi A, Ashcroft SJH, Molnar E: Metabotropic glutamate and GABAB receptors contribute to the modulation of glucose-stimulated insulin secretion in pancreatic beta cells. Diabetologia45 :242 –252,2002[Medline]
  13. Weaver CD, Gundersen V, Verdoorn TA: A high affinity glutamate/aspartate transport system in pancreatic islets of Langerhans modulates glucose-stimulated insulin secretion. J Biol Chem273 :1647 –1653,1996
  14. Bertrand G, Gross R, Puech R, Loubatieres-Mariani MM, Bockaert J: Evidence for a glutamate receptor of the AMPA subtype which mediates insulin release from rat perfused pancreas. Br J Pharmacol106 :354 –359,1992[Abstract]
  15. Bertrand G, Gross R, Puech R, Loubatieres-Mariani MM, Bockaert J: Glutamate stimulates glucagon secretion via an excitatory amino acid receptor of the AMPA subtype in rat pancreas. Eur J Pharmacol237 :45 –50,1993[Medline]
  16. Reetz A, Solimena M, Matteoli M, Folli F, Takei K, De Camilli P: GABA and pancreatic ß cells: co-localization of glutamic acid decarboxylase (GAD) and GABA with synaptic-like microvesicles suggests their role in GABA storage and secretion. EMBO J10 :1275 –1284,1991[Abstract]
  17. Rorsman P, Berggren PO, Bokvist K, Ericson H, Mohler H, Otenson VG, Smith PA: Glucose-inhibition of glucagon secretion involves activation of GABAA- receptor chloride channels. Nature341 :233 –236,1989[Medline]
  18. Robbins MS, Grouse LH, Sorenson RL, Elde RP: Effect of muscimol on glucose-stimulated somatostatin and insulin release from the isolated, perfused rat pancreas. Diabetes30 :168 –171,1981[Abstract]
  19. Gilon P, Bertrand G, Loubatieres-Mariani MM, Remacle C, Henquin JC: The influence of {gamma}-aminobutyric acid on hormone release by the mouse and rat endocrine pancreas. Endocrinology129 :2521 –2529,1991[Abstract]
  20. Nakanishi S: Molecular diversity of glutamate receptors and implications for brain function. Science258 :597 –603,1992[Medline]
  21. Wang Y, Small DL, Stanimirovic DB, Morley P, Durkin JP: AMPA receptor-mediated regulation of a Gi-protein in cortical neurons. Nature389 :502 –504,1997[Medline]
  22. Gotoh M, Maki T, Satomi S, Porter J, Bonner-Weir S, O’Hara CJ, Monaco AP: Reproducible high yield preparation of rat islets by stationary in vitro digestion following pancreatic ductal or portal venous collagenase injection. Transplantation43 :725 –730,1987[Medline]
  23. Sambrook J, Fritsch EF, Maniatis T: A Laboratory Manual. 2nd ed. Cold Spring Harbor, NY, Cold Spring Harbor Laboratory,1989
  24. Tanabe Y, Masu M, Ishii T, Shigemoto R, Nakanishi S: A family of metabotropic glutamate receptors. Neuron8 :169 –179,1992[Medline]
  25. Hayashi M, Otsuka M, Morimoto R, Hirota S, Yatsushiro S, Takeda J, Yamamoto A, Moriyama Y: Differentiation-associated Na+-dependent inorganic phosphate cotransporter (DNPI) is a vesicular glutamate transporter in endocrine glutamatergic systems. J Biol Chem276 :43400 –43406,2001[Abstract/Free Full Text]
  26. Saugstad JA, Kinzie JM, Shinohara MM, Segerson TP, Westbrook GL: Cloning and expression of rat metabotropic glutamate receptor 8 reveals a distinct pharmacological profile. Mol Pharmacol51 :119 –125,1997[Abstract/Free Full Text]
  27. Thomas NK, Wright RA, Howson PA, Kingston AE, Schoepp DD, Jane DE: (S)-3,4-DCPG, a potent and selective mGluR8a receptor agonist, activates metabotropic glutamate receptors on primary afferent terminals in the neonatal rat spinal cord. Neuropharmacol40 :311 –318,2001[Medline]
  28. Acher FC, Tellier FJ, Azerad R, Brabet IN, Fagni L, Pin JP: Synthesis and pharmacological characterization of aminocyclopentanetricarboxylic acids: new tools to discriminate between metabotropic glutamate receptor subtypes. J Med Chem40 :3119 –3129,1997[Medline]
  29. Toms NJ, Jane DE, Kemp MC, Bedingfield JS, Roberts PJ: The effect of (RS)-a-cyclopropyl-4-phosphonophenylglycine ((RS)-CPPG), a potent and selective metabotropic glutamate receptor antagonist. Br J Pharmacol119 :851 –854,1996[Abstract]
  30. Howson PA, Jane DE: Actions of LY341495 on metabotropic glutamate receptor-mediated responses in the neonatal rat spinal cord. Br J Pharmacol139 :147 –155,2003[Abstract/Free Full Text]
  31. Ito I, Kohda A, Tanabe S, Hirose E, Hayashi M, Mitsunaga S, Sugiyama H: 3,5-Dihydroxyphenylglycine: a potent agonist of metabotropic glutamate receptors. Neuroreport3 :1013 –1016,1992[Medline]
  32. Porter RH, Roberts PJ, Jane DE, Watkins JC: (S)-homoquisqualate: a potent agonist at the glutamate metabotropic receptor. Br J Pharmacol106 :509 –510,1992[Abstract]
  33. Hayashi Y, Tanabe Y, Aramori I, Masu M, Shimamoto K, Ohfune Y, Nakanishi S: Agonist analysis of 2-(carboxycyclopropyl)glycine isomers for cloned metabotropic glutamate receptor subtypes expressed in Chinese hamster ovary cells. Br J Pharmacol107 :539 –543,1992[Abstract]
  34. Monaghan DT, Bridges RJ, Cotman CW: The excitatory amino acid receptors: their classes, pharmacology, and distinct properties in the function of the central nervous system. Annu Rev Pharmacol Toxicol29 :365 –402,1989[Medline]
  35. Law SF, Manning D, Reisine T: Identification of the subunits of GTP-binding proteins coupled to somatostatin receptors. J Biol Chem266 :17885 –17897,1991[Abstract/Free Full Text]
  36. Gromada J, Hoy M, Olsen HL, Gotfredsen CF, Buschard K, Rorsman P, Bokvist K: Gi2 proteins couple somatostatin receptors to low-conductance K+ channels in rat pancreatic {alpha}-cells. Pflugers Arch442 :19 –26,2001[Medline]
  37. Schoepp DD, Jane DE, Monn JA: Pharmacological agents acting at subtypes of metabotropic glutamate receptors. Neuropharmacol38 :1431 –1476,1999[Medline]
  38. Gromada J, Hoy M, Buschard K, Salehi A, Rorsman P: Somatostatin inhibits exocytosis in rat pancreatic {alpha} cells by Gi2-dependent activation of calcineurin and depriming of secretory granules. J Physiol535 :519 –532,2001[Abstract/Free Full Text]